KEGG   Novosphingobium aromaticivorans: Saro_1301Help
Entry
Saro_1301         CDS       T00322                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saro_1301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1301
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saro_1301
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saro_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1346261..1347061)
Genome map
AA seq 266 aa AA seqDB search
MTRLSNAFAKGRPALVTFVTGGDPTPGATDAILDALVEGGADVIELGMPFTDPMADGPAI
QLANLRSLGAGTKTADVFRIAADFRARHPEVPLVLMGYANPMVTRGPDWFAAECVKAGVD
GVICVDIPPEEDPELGPALRGAGVSLIRLATPTTDAARLPAVLEGSSGFLYYVSVAGITG
MQQAAQASIEEAVARIKQSATIPVAVGFGVRTPEQAAAIAKVADGVVVGSALVDLVARHG
ADAAGPVKELTAALAAAVHSARKEIA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttccaacgccttcgccaagggccgccccgccctcgtcacgttcgtcacc
ggcggcgatcccacgccaggcgccacggatgcgatcctcgacgcgctcgtcgaaggcggc
gccgacgtgatcgagctgggcatgcccttcaccgatcccatggccgatggccccgcgatc
cagctcgccaaccttcgcagcctcggcgccggcacgaagacggccgacgttttccgcatc
gccgccgatttccgcgcacgtcatccggaagtgccgctggtgctgatgggctatgccaat
cccatggtcacgcgcggacccgactggttcgccgccgaatgcgtgaaggccggggtcgat
ggcgtgatctgcgtcgacatcccgcccgaggaagacccggaactcggccccgccctgcgc
ggcgcgggcgtctcgctgatccgcctcgccacgccgacgaccgatgcggcgcggctcccc
gccgtgctcgaaggctcgtccgggttcctctactacgtctcggtcgcaggcatcaccggc
atgcagcaggcggcacaggcctcgatcgaagaggcggttgcccgcatcaagcagtccgcc
acgatcccggtcgcggtcggcttcggtgtgcgcacgcccgaacaggctgccgcaatcgcc
aaggtggccgatggcgtcgtcgttggctcggcactggtcgatctggtcgcccggcatggc
gccgatgcggcaggtccggtgaaggaacttaccgccgcgcttgccgctgccgtccactct
gcccgcaaggaaatcgcatga

DBGET integrated database retrieval system