KEGG   Novosphingobium aromaticivorans: Saro_1301Help
Entry
Saro_1301         CDS       T00322                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00260  Glycine, serine and threonine metabolism
nar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
nar01230  Biosynthesis of amino acids
Module
nar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1301
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saro_1301
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saro_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Dus
Motif
Other DBs
NCBI-ProteinID: ABD25745
UniProt: Q2G8S8
Position
complement(1346261..1347061)
Genome map
AA seq 266 aa AA seqDB search
MTRLSNAFAKGRPALVTFVTGGDPTPGATDAILDALVEGGADVIELGMPFTDPMADGPAI
QLANLRSLGAGTKTADVFRIAADFRARHPEVPLVLMGYANPMVTRGPDWFAAECVKAGVD
GVICVDIPPEEDPELGPALRGAGVSLIRLATPTTDAARLPAVLEGSSGFLYYVSVAGITG
MQQAAQASIEEAVARIKQSATIPVAVGFGVRTPEQAAAIAKVADGVVVGSALVDLVARHG
ADAAGPVKELTAALAAAVHSARKEIA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttccaacgccttcgccaagggccgccccgccctcgtcacgttcgtcacc
ggcggcgatcccacgccaggcgccacggatgcgatcctcgacgcgctcgtcgaaggcggc
gccgacgtgatcgagctgggcatgcccttcaccgatcccatggccgatggccccgcgatc
cagctcgccaaccttcgcagcctcggcgccggcacgaagacggccgacgttttccgcatc
gccgccgatttccgcgcacgtcatccggaagtgccgctggtgctgatgggctatgccaat
cccatggtcacgcgcggacccgactggttcgccgccgaatgcgtgaaggccggggtcgat
ggcgtgatctgcgtcgacatcccgcccgaggaagacccggaactcggccccgccctgcgc
ggcgcgggcgtctcgctgatccgcctcgccacgccgacgaccgatgcggcgcggctcccc
gccgtgctcgaaggctcgtccgggttcctctactacgtctcggtcgcaggcatcaccggc
atgcagcaggcggcacaggcctcgatcgaagaggcggttgcccgcatcaagcagtccgcc
acgatcccggtcgcggtcggcttcggtgtgcgcacgcccgaacaggctgccgcaatcgcc
aaggtggccgatggcgtcgtcgttggctcggcactggtcgatctggtcgcccggcatggc
gccgatgcggcaggtccggtgaaggaacttaccgccgcgcttgccgctgccgtccactct
gcccgcaaggaaatcgcatga

DBGET integrated database retrieval system