KEGG   Novosphingobium aromaticivorans: Saro_1302Help
Entry
Saro_1302         CDS       T00322                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saro_1302
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1302
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saro_1302
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saro_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1347061..1348275)
Genome map
AA seq 404 aa AA seqDB search
MTAQTPNSFRNLPDERGHFGQFGGRYVAETLMPLILDLEREYNAAKADPAFKAEFDDLLE
HYVGRPSPLYFAPRLTEELGGAQVWFKRDELNHTGAHKINNCIGQILLAMRMGKTRIIAE
TGAGQHGVATATVCARFGLPCVIFMGATDVARQAPNVFRMKLLGAEVVPVTAGAGTLKDA
MNEALRDWVANVHNTFYIIGTAAGPHPYPELVRDFQSVIGKEARAQMLSRTGRLPDLLVA
AIGGGSNAIGLFHPFLDDPSVRMLGVEAAGHGLDKEHAASLAGGRPGILHGNKTYLLQDE
DGQITEGHSISAGLDYPGIGPEHAWLKEIGRVDYTSVTDTEALDAFQLLCRTEGIIPALE
PAHAIAAVKKVAPTMGKDEIILANLCGRGDKDIFSVAEHLGVSL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagactcccaacagcttccgcaacctgcccgacgagcgcggccacttcggc
cagttcggcggtcgctacgtcgccgaaacgctgatgccgctgatcctcgatctcgaacgc
gagtacaacgccgcgaaagccgacccggcgttcaaggccgagttcgacgacctcctggaa
cactatgtcggccgcccgagcccgctctacttcgcgccgcggctgaccgaggagctgggc
ggagcacaggtctggttcaagcgcgacgagctgaaccacaccggcgcgcacaagatcaac
aactgcatcggccagatcctgctcgccatgcgcatgggcaagaccaggatcatcgccgag
accggcgcgggccagcacggcgtggccaccgccaccgtctgcgcgcgcttcggcctgccc
tgcgtgatcttcatgggtgcgaccgacgttgcccgccaggcgcccaacgtgttccgcatg
aagctgctcggcgccgaagtcgtgccggtcacggcgggcgcgggcacgctgaaggacgcg
atgaacgaggcgctgcgcgactgggtcgccaacgtccacaacactttctacatcatcggc
accgccgcgggcccgcacccctatccggaactggtccgcgacttccagagcgtgatcggc
aaggaagcgcgcgcgcagatgctctcccgcaccggccgcctgcccgaccttctggtcgcg
gcgatcggcggcggctccaacgccatcggcctgttccaccccttcctcgacgacccgagc
gtcaggatgctgggcgtggaggccgccggccacggcctcgacaaggagcacgccgccagc
ctcgcgggcggacgccccggcatcctccacggcaacaagacctacctgctgcaggacgag
gacggccagatcaccgaaggtcactcgatctcggctggcctcgactatcccggcatcggc
ccggaacacgcctggctgaaggaaatcggccgcgtcgactacacctcggtcaccgatacc
gaggcgctcgacgccttccagctcctgtgccgcaccgaaggcatcatccccgcgctcgaa
ccggcccatgccatcgcggcggtcaagaaggtcgccccgaccatgggcaaggacgaaatc
atcctcgccaacctatgcggccgtggcgacaaggacatcttctcggtggccgaacatctg
ggggtgtcgctctga

DBGET integrated database retrieval system