KEGG   Novosphingobium aromaticivorans: Saro_1375Help
Entry
Saro_1375         CDS       T00322                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_1375
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Saro_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Sacchrp_dh_NADP NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABD25819
UniProt: Q2G8K4
Position
1421222..1422379
Genome map
AA seq 385 aa AA seqDB search
MTRTISVLGATGSIGASTLDLIRRERDKWRVVALTANGNARELAALAREFGAEVAVVADE
SALAALRDALAGSGIEAAAGPGALIDAAALGAEVTVAAIVGCAGLAPTMAAIERGGIIAL
ANKEALVSAGDVMMAAVERHGATLLPVDSEHNAIFQCLQGNDIAHVRAITLTASGGPFRD
WTTEQLQRATPAEAVRHPNWSMGAKISVDSATMMNKGLEFIEAFHLFPVGVERLRIIVHP
QSIVHSMVEYRDGSTLAQLGPSDMRVPIASALAWPARMDTPCDPLDLATIGQLTFRAPDE
QRFPATRLAREAVIAGGAAPAVLNAANEMAVAAFLGGQIGFTRIVQCCEDVLAHGLAPAP
RSLAEVIAVDAEARARALELMEPVR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaacgatttccgtccttggcgcgaccggatcgatcggagcctcgacgctggac
ctgatccggcgcgagcgcgacaagtggcgcgtagtggcgctgaccgcgaacggtaatgcg
cgcgaactggccgcgctcgcccgcgagttcggggctgaggtcgcggttgttgccgacgag
agcgcgctggcggccttgcgggatgcgctggctggatcgggcatcgaggcggcggctgga
ccaggcgcgttgatcgatgcggctgcgcttggtgcggaagtgactgtcgccgcgatcgtc
ggatgcgccgggctcgcgccgaccatggcagccatcgagcgcggcgggatcatcgcgctg
gccaacaaggaagcgctggtttccgctggcgacgtcatgatggcggcggtggagcgccac
ggcgccacgctgctgccggtcgattcggaacacaacgcgatcttccagtgcctacagggt
aacgacatcgcccacgttcgcgcgatcacgctcacggcaagcggcggtccgttccgcgac
tggacgaccgagcagttgcagcgcgccacgcccgccgaggcggtcaggcatccgaactgg
tcgatgggcgcgaagatcagcgtcgattccgcaacgatgatgaacaaggggctcgagttc
atcgaggccttccacctgttccccgtcggcgtggaacggctgcgcatcatcgtgcatccc
cagtccatcgtgcattccatggtcgaataccgcgatggttcgacgctggcgcaactcggg
ccttcggacatgcgcgtgccgatcgcgtcggcgcttgcctggccggcccggatggacacg
ccttgcgatccgcttgatcttgcgaccattgggcagctgaccttccgtgcaccggacgag
cagcggtttcccgcgacgcggctggcacgcgaagccgtgattgcgggcggtgcggcgcca
gccgtgctgaacgcggcgaacgaaatggcggttgcggcgttccttggcggtcagattggg
ttcacccggatcgtgcaatgttgcgaggacgtgcttgcgcacggtcttgcgcctgccccg
cgcagtctggccgaggttatcgcggtcgatgcagaggcgcgggcgcgggcgctcgaactg
atggagccggtgcgttga

DBGET integrated database retrieval system