KEGG   Novosphingobium aromaticivorans: Saro_1658Help
Entry
Saro_1658         CDS       T00322                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Saro_1658
Enzymes [BR:nar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Saro_1658
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1735553..1737718)
Genome map
AA seq 721 aa AA seqDB search
MKPPASAIDALLDGTHADPFSLLGIHEGPDGAFARAVLPGAEEAVAWSLSGKKLGKLSRV
DGRGLFEGKVKGPRQPVRYACKADGHEWLVTDPYSFGPVLGPLDDFLIAEGTHLRLFDKM
GAHLIEHEGARGVHFAVWAPNARLVSVVGDFNDWDHRRHPMRRRADIGVWEIFIPDIGEH
RAYKYRIVGHDGGVLPLKADPYALAAEFRPSTASLTAHPVKMDWADAAHRAHWASVDARR
EPMSIYEVHPGSWQKPHEEGFHTWDELADRLIPYVAEMGFTHIEFLPVSEHPYDPSWGYQ
TTGLYAPSARFGPPEGFARFVDGAHRAGISVLIDWVPAHFPTDEHGLVRFDGTALYEHED
PRLGFHPDWNTLIYNFGRREVVSFLVNNALFWAERYHVDGLRVDAVASMLYRDYSRKAGE
WIPNAEGGRENWEAVEFLKAMNRAVYGSHAGFLTIAEESTAWPGVSKPAFDGAPRENLGF
GFKWNMGFMHDTLKYMAREPIHRRYHHDEITFGLMYAFSENFVLPLSHDEVVHGKGSLLN
KMSGDDWQKFANLRAYYGLMWGYPGKKLLFMGQEFAQRREWSEARALDWDLLQAPAHEGI
RRWVRDLNRVYASRPALHARDCEPEGFEWLVVDDAEASIFAWLRKAPGARPVAVICNMTP
QVHDHYRLPLPLDGEWREVLNSDAEDYGGSGIGNLGKVTAEQGAAFVVLPPLATLMLEFE
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaccggcgagcgccatcgatgcccttctggacgggacgcacgccgatcctttc
tcgcttctcggcatccacgaaggaccggacggcgccttcgcccgcgccgtcctgcccggc
gcggaagaggccgtggcatggtcgctctcgggcaagaagctgggcaagctcagccgcgtc
gacgggcgcggcctgttcgaaggcaaggtaaagggaccgcgccagccagtccgctatgcc
tgcaaggccgatgggcacgaatggctcgtcaccgacccctattccttcggccccgtcctc
ggcccgctcgacgatttcctgatcgccgagggcacgcatctgcggctgttcgacaagatg
ggtgcgcacctgatcgagcacgagggcgcgcgcggcgtgcacttcgcggtttgggcgccc
aacgcgcggctcgtctcggtcgtcggtgatttcaacgactgggatcaccgccgccacccg
atgcgccgccgggcggacatcggcgtctgggaaatcttcattcccgacatcggcgaacat
cgcgcctacaagtaccgcatcgtcggccacgacggcggtgtgcttccgctcaaagccgat
ccctatgcgcttgccgccgaattccgccccagcaccgcctcgctcaccgcgcacccggtc
aagatggactgggccgacgccgcccaccgcgcgcactgggcctcggtcgacgcgcgccgc
gagccgatgtcgatctacgaggtccaccccggctcgtggcagaagccgcacgaggaaggc
ttccatacctgggatgagttggccgaccgcctgatcccctatgtcgcggaaatgggcttc
acccacattgaattcctgcccgtctccgagcacccctacgatccgagctggggctaccag
acgaccggcctctacgccccgtcagcccgcttcggcccgccggaggggttcgcccgtttc
gtcgatggcgcccaccgggcgggcatttccgtccttatcgactgggtccctgcccacttc
ccgacggacgagcacggcctcgtccgttttgacggcacagcgctctacgaacacgaagac
cctcgcctcggcttccatcccgactggaacacgctgatctacaacttcggccgccgcgag
gtcgtcagcttcctcgtcaacaacgcgctgttctgggccgaacgctatcatgtcgacggg
ctgcgcgtggatgcggtcgcctcgatgctgtaccgcgactactcgcgcaaggctggcgag
tggattcccaacgccgaaggcggccgcgagaactgggaagcggtcgagttcctcaaggcg
atgaaccgggccgtctatggcagccacgccggcttcctcaccatcgccgaggaatcaacc
gcgtggcccggcgtatccaaaccggcgttcgatggcgccccgcgcgagaacctcggcttc
ggcttcaagtggaacatgggcttcatgcacgatacgctgaagtacatggcgcgcgagccg
atccaccgccgctaccatcacgatgagatcaccttcggcctgatgtacgccttcagcgag
aacttcgtcctgccgctgagccatgacgaagtggtccacggcaagggcagcctgctcaac
aagatgagcggcgatgactggcagaagttcgccaacctgcgcgcctattacgggctgatg
tggggctatcccggcaagaagctgctgttcatgggccaggaattcgcccagcgccgcgag
tggagcgaggctcgcgcgctcgactgggacctgctccaggctcccgcccacgagggcatc
cgccgctgggtacgcgatctcaaccgcgtctatgccagccgccccgcactccacgcccgc
gattgcgagccggaagggttcgaatggctggtggtggacgatgcggaagcctcgatcttc
gcctggctgcgcaaggcaccgggcgcaaggccggtcgctgtgatctgcaacatgaccccg
caggtccacgaccactatcgcctgccgcttccgctcgatggggaatggcgcgaggtcctg
aacagcgatgccgaggactatggcggcagcggcatcggcaatcttggcaaggtcactgcc
gaacaaggcgccgctttcgtggtcctcccgccgctggccacgctgatgcttgaattcgaa
ggataa

DBGET integrated database retrieval system