KEGG   Novosphingobium aromaticivorans: Saro_1685Help
Entry
Saro_1685         CDS       T00322                                 

Definition
(GenBank) Amine dehydrogenase
  KO
K15229  
methylamine dehydrogenase heavy chain [EC:1.4.9.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Saro_1685
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.9  With a copper protein as acceptor
    1.4.9.1  methylamine dehydrogenase (amicyanin)
     Saro_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1769431..1770606
Genome map
AA seq 391 aa AA seqDB search
MRLFALALALSVSGAALAATPAAKAPYPKPLPEEPIPASAKLPSQWPASVVLIHDFHFSS
IVDGRVMVVDTASTDHPVKGMVRAAQFANMLVSPSRGEILTSETFYSRLTRGERTDAVTI
WDMATLQPKGEIVMPGGKRQQSVTYPQLFQFTNGEKWALVANFTPAQSVSVLDIDARKVI
AEIDLPGCAQLYPTGERGFTSFCADGSLFSVKLGPDGQAVSSKTVEKVQDIDNQPLFSTP
AWVGRTAWFVSYRGQIQAFDFSGDVARPLPGSFNIGTADGAAPEWRPGGWQVIAADGAGK
LYVLMSPNGREGSHKDGGTEVWVIDTVKKARVGRIALNGVASAIALTREATPRLVVARGD
GTIDVHDPATGALVRSLGTAGGANPIVITAP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtttgcgctggcccttgccctttccgtttccggtgcggcgctcgccgcaact
ccggccgcaaaggcgccgtatcccaaacctctgccggaggagcccattccggcgtcggcc
aaacttccgtcccagtggccggccagtgtcgtgctgatccacgactttcatttcagctcg
atcgtcgatggacgggtcatggtggtggacaccgcgtcgaccgaccatccggtgaagggc
atggttcgcgcggcccagttcgccaacatgctggtctcgcctagccgtggcgagatactg
acgtccgagacattctattcccggctcacgcggggtgagcgtaccgacgccgtgaccatc
tgggacatggccacgctccagcccaagggtgaaatcgtcatgccgggcggcaagcgccag
cagtcggtcacctatccgcagctcttccagttcacgaacggcgagaagtgggcgctggtc
gccaacttcaccccggcccagtcggtcagcgtcctcgacatcgatgcgcgcaaggtgatt
gccgagatcgacctgccgggctgcgcccagctctatcccaccggcgaacgtggatttacc
agcttctgcgccgatggctcgctgttcagcgtcaagcttggccctgatggccaggcggtc
tcgtcgaagacggtcgagaaggtgcaggacatcgacaaccagccgctgttcagcacgccc
gcgtgggtcggcaggactgcatggttcgtcagctatcgcgggcagatccaggctttcgat
ttctcgggtgacgtggcgcgcccgcttcccggcagcttcaacatcggcactgccgatggc
gccgcccccgaatggcgtccgggcggctggcaggtcatcgccgccgatggcgcgggcaag
ctctacgtcctgatgagccctaacgggcgcgagggcagccacaaggacggcggcaccgag
gtctgggtcatcgacacggtgaagaaggcccgcgtgggccggatcgcgctcaacggggtc
gcgtctgcgatcgcgctgacccgcgaggcgacgccccgcctggtcgttgcgcgcggggat
ggcaccatcgatgttcacgacccggcgaccggcgcgctcgtgcgctcgctcggcactgcc
ggcggtgccaatcccatcgtcatcacggcaccctga

DBGET integrated database retrieval system