KEGG   Novosphingobium aromaticivorans: Saro_1691Help
Entry
Saro_1691         CDS       T00322                                 

Definition
(GenBank) TonB-dependent receptor
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1773187..1775418
Genome map
AA seq 743 aa AA seqDB search
MRERLYRGIALAGVAAASIFAAAPVLAQEVQSDRAVPDGEIVVTATKRAESLQSVPISVS
AIGGDTLAKARVGSVDSLVTKVANLQLTSIVGDNTPIFALRGVSMSDYSLNQSSPVATYY
DEVYKGNFAFLGVTMFDLERVEVLRGPQGTLYGKNTTGGAVNIIANSAKLGETSGYFSAG
YGNYDRFDLNGAVNVPLGEKAALRIAGTYARADGWFKNVVPGKPDLASTDEYAIRGTLNF
EASDTVRFVLRASTSYQNPQNYGIYAQPEDVNRPGLDRWEIASNIATKRKARTYSVALTS
NFDVSDTLTVTSITSWDKGNLFFYEDTDGTASQLLEIPYTDRATQFAQDLRLTSDTGGPF
DFILGAYFNREKVYNETAFEIGKDIDLTGDNIVTADDCVEGLTNEDGSDDGIACLFRNRF
DQVKKSYAIYSDLKYQVTDAVTLRGGLRYTHDTGRQSGFRSDALGVDGSEVANLIPLSSL
SYSQDNLSGKIGLDYKLADGNLLYASVSRGYRAPSFNAQAFFDPSELSVAKPEQVTSYEV
GAKTQFLDRRITLNVAGFYYDYRNQQFINVDPVLGSQTLLNIPKSRIYGGEAELTIRASD
RLTLHSGMGVLATKIQRGSVSGVDVSGNRLSNAPTFTFNATIDLTLVDGDMGKLSVHPDV
AYQSSQFFEVLNIPRLRQTSYALVGGHIDWESADGRFNASVWGKNLSNKFYFTSRVDLLA
GFGFDYNHIGNPRTYGVTVGAKF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagggaacgtctttaccgtggaatcgcgctggcaggggtagccgccgcatccattttc
gccgcagcgcccgtattggcgcaggaagtgcaatccgacagggccgtgcccgacggcgag
atcgtcgtgaccgcaaccaagcgtgcggaaagcctgcaatcggtccccatctcggtctcg
gccatcggcggcgatacgcttgccaaggcgcgggtcggcagcgtggacagcctggtgacc
aaggtcgccaatcttcagctcacgtcgatcgtgggcgacaacacgccgatcttcgcgctg
cgcggcgtatcgatgtccgactacagcctcaaccagtcgagccccgtcgcaacctattac
gacgaagtctacaagggcaacttcgccttcctcggcgtcaccatgttcgaccttgagcgc
gtcgaggtactgcgcgggccgcagggcacgctctatggcaagaacaccaccggcggcgcg
gtcaacatcatcgccaacagtgcgaagctgggcgagaccagcggctatttcagcgccggc
tatggcaactatgaccgcttcgacctcaacggcgcggtcaacgtgccgctgggcgaaaag
gcggccctgcgcatcgcgggcacttatgcccgggccgatggctggttcaagaacgtggtc
ccgggcaagcccgatctcgcctcgaccgacgagtacgccatccgaggcacgctgaacttc
gaggcgagcgataccgtccgcttcgtcctgcgcgcgtcgaccagctaccagaacccgcag
aactatggcatctatgcccagcccgaagacgtcaatcgccccggtctcgaccgctgggag
atcgcctcgaacatcgccaccaagcgcaaggcgcgcacctattcggtcgcgcttaccagc
aacttcgacgtgtcggatacgctgaccgtcaccagcatcacctcgtgggacaagggcaac
ctgttcttctacgaggacaccgacggcaccgcctcgcaactgctcgaaatcccctatacc
gaccgcgccacccagttcgcgcaggacctgcgcctgaccagcgacaccggtggcccgttc
gatttcatcctcggcgcctacttcaaccgcgagaaggtctacaacgagactgccttcgag
atcggcaaggacattgaccttaccggcgacaacatcgtcacggcagacgactgcgtcgaa
ggcctgaccaacgaagatggcagcgacgatggcatcgcctgcctcttccgcaaccgcttc
gaccaggtgaagaagagctacgcgatctattcggacctcaagtaccaggtcaccgatgcg
gtgaccctgcgtggcggcctgcgctatacccacgatacgggccggcagagcggcttccgc
tccgatgcgctgggcgtcgacgggtccgaggtggccaacctgatccccttgtcctcgctc
agctattcgcaggacaacctctccgggaagatcggcctcgactacaagctggccgatggc
aacctgctctacgccagcgtcagccggggctaccgcgcgcccagcttcaacgcgcaggcc
ttcttcgatccgtcggagctttcggtcgccaagcccgagcaggtgacctcgtacgaagtc
ggcgcgaagacgcagttcctcgaccgccgcatcacgctcaacgtggccgggttctactac
gactaccgcaaccagcagttcatcaacgtcgacccggtactgggctcgcagacgctgctg
aacattcccaagtcgcgcatctatggcggcgaggccgagctgacgatccgcgccagcgac
cggctgaccctgcacagcggcatgggcgtccttgccacaaagatccagcgcggcagcgtg
agcggcgtggacgtttccggcaaccgcctgtccaacgcaccgacctttaccttcaacgcc
acgatcgacctgacgctggtcgatggcgacatgggcaagctctcggtccacccggacgtg
gcctaccagtcgagccagttcttcgaagtgctcaacatcccccgcctgcgccagacttcc
tacgcgctggtcggcgggcacatcgactgggaaagcgccgacgggcgcttcaatgcctcg
gtctggggcaagaacctgtccaacaagttctacttcacctcgcgcgtggacctgctggcg
ggcttcggcttcgactacaaccacatcggcaatccgcgcacttacggcgtgacagtgggc
gcgaagttctga

DBGET integrated database retrieval system