KEGG   Novosphingobium aromaticivorans: Saro_1695Help
Entry
Saro_1695         CDS       T00322                                 

Definition
(RefSeq) ATP dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nar00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Saro_1695
Enzymes [BR:nar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Saro_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1779469..1782000
Genome map
AA seq 843 aa AA seqDB search
MGRNDPLAAYNAKRDFARTAEPAGKRKSSATGNLFIVQKHDATRLHWDFRMEVDGVLKSW
AVTRGPSPDPDDKRLAVQTEDHPLEYARFEGIIPEGEYGGGTVMLWDKGTWEPVEGKSAK
DLEKGHLHFRLEGERMKGEWLLVRLKRRGNEKRDNWLLRKLDDAYAGQGDQLVERGLTSV
LTGRTMAEIASDKAGSHSLKGKRGKAFASVMEEAGTHNRKVGKARGKAPSRARRNAPLPA
FQPVQLATLVDTVPDGRQWLYEIKFDGYRALVAVRGTEVRVFTRSGLDWTEKFAPLARHL
AGLKLPSCLIDGEIVAADADGNPDFSRLQAVLKRGHGEQGEGDALSFHAFDLLELEGEDL
KPLPNVERKQKLAALLAGVSPPIHVADHIIGGGEKLLGALCGAGQEGIICKRADAAYAGK
RTQNWLKVKCVARQEFIVVGFTRSSARRRPFASLLLAQREGKALVYKGKVGTGFDEDLLQ
DLATRFEALKVDEGPLDVPITEARGVTWLKPELVAEIAFAEFTAEGRVRHASFVGLREDK
KAADVVPERPAPLVVQPEIVPISNRERVIFPESGQTKGDLADYYAAMAPAMLPFIANRPV
SLVRCPQGRARHCFFQKHDSGSFGEHVHHVPIREKDGNEEEYLFVSDAAGILSCVQMGTI
EFHGWCSLASDVEAPERMVIDLDPDEGLDFNDVKRAARDIRDRLSDLGLVSFAMLSGGKG
VHVVVPLRPDHTWEAHASFAERFARALALAEPDRYVATMSKARRKGRIFIDWLRNRRGST
AVMPYSARARANAPVAVPIAWEELDDFANAHPFCIGDTAGLLKRSEGKSLRGWGMAQQSL
PDV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcaacgatccgctcgccgcctacaacgccaagcgcgacttcgcgcgcactgcg
gaacctgccggcaagcgcaagtccagcgccacgggcaatctcttcatcgtccagaagcac
gacgccacccgcctgcactgggacttccgcatggaggttgatggcgtgctcaagagttgg
gccgtgacccggggccctagccccgatcccgacgacaagcgcctcgctgtccagaccgag
gaccaccccctcgaatacgcccggttcgaaggcatcatccccgaaggcgagtacgggggc
ggcaccgtcatgctctgggacaagggcacctgggagccggtcgagggcaagagcgccaag
gatctggaaaaggggcacctccatttccgcctcgagggggagcggatgaagggcgaatgg
ctgcttgtccgcctcaagcgtcgcggcaatgaaaagcgcgacaactggctcctgcgcaag
ctggacgacgcctatgcgggccagggcgaccagctcgtcgagcgcggcctgaccagcgtc
ctcaccggccgcaccatggccgaaatcgcctccgacaaggctggcagccattcgctcaaa
ggcaagcgcggcaaggccttcgcttcggtgatggaagaagcaggcacgcataaccgcaag
gtcggcaaggcgcgcggcaaggcaccgtccagggcgcgccggaacgcaccgctacccgcc
ttccagcccgtccagctcgcaaccctggtcgatacggtgcccgatgggcgccaatggctg
tacgagatcaagttcgacggctaccgcgcgctcgtcgcagtgcggggaaccgaggtccgc
gtcttcacccgcagcggtctcgactggaccgaaaagttcgcgccgcttgcccgccatctc
gccgggctcaagctgccgtcgtgcctgatcgacggcgagatcgtcgccgccgatgccgat
ggcaatcccgatttctcgcggcttcaagccgtgctcaagcgcgggcatggcgaacagggc
gagggtgatgccttgtcgttccacgccttcgacttgctggaactcgaaggcgaagacctg
aagcccctgcccaatgtagagcgcaagcagaagctcgccgcgctgcttgccggggtctcg
ccgccgatccacgtcgccgaccacatcatcggcggcggcgaaaagctgcttggcgcgctg
tgcggcgcggggcaggaagggatcatctgcaagcgcgcggacgcggcctatgcgggcaag
cggacgcagaactggctgaaggtgaagtgcgtggcccgccaggaattcatcgtcgtcggc
ttcacccggtccagcgcccgccgccgccctttcgcctcgcttctcctggcccagcgcgag
ggaaaggcgctggtctacaagggcaaggtgggcaccggctttgacgaggacctgctgcaa
gacctcgccacccggttcgaagccctcaaggtcgacgaaggtccgctcgatgtgcccata
accgaagcgcgcggcgtgacctggctgaaacccgaactcgtcgcggaaatcgcctttgcc
gaatttaccgccgaaggccgtgtccgccacgccagcttcgtcggtctgcgcgaagacaag
aaggccgcggacgtcgtccccgaacggcccgccccgctggtcgttcagccggaaatcgtg
ccgatcagcaatcgcgagcgggtgatctttcccgaaagcggccagaccaagggcgacctt
gccgattactacgccgcgatggcgcccgcgatgctcccgttcatcgccaaccgccccgtc
agcctcgtccgctgtcctcaggggcgcgcgcgccactgcttcttccagaagcacgatagc
ggctcgttcggcgaacacgtccaccacgttccgatccgcgagaaggatggcaacgaggag
gagtatctgttcgtcagtgacgccgccggcattctctcgtgcgtgcagatgggcacgatc
gagttccacggctggtgttctctggcaagcgatgtcgaggcgcccgaacggatggtcatc
gacctcgatcccgacgaggggctcgatttcaacgacgtcaagcgcgccgcccgcgatatt
cgtgaccgcctgtccgacctcggtctcgtcagctttgccatgctttccggcggcaagggc
gttcacgtcgtcgtgccgctgcggcccgaccacacctgggaggctcacgccagctttgcc
gaacgttttgcccgcgcgctcgccctggcggaacccgatcgctacgtcgcaacgatgagc
aaggccaggcgcaagggccgcatcttcatcgactggctccgcaaccggcgcggcagcacc
gctgtcatgccctattcggcgcgcgcccgcgccaacgctcccgtcgcggtgccgatcgcc
tgggaggaactcgacgacttcgcgaacgcccaccccttctgcatcggcgatacggcagga
ctactcaagcgtagcgaaggcaagtcgctgcgcggctggggaatggcccaacagtccctc
ccggacgtttag

DBGET integrated database retrieval system