KEGG   Novosphingobium aromaticivorans: Saro_1695Help
Entry
Saro_1695         CDS       T00322                                 

Definition
ATP dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nar03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nar03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nar03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:nar03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1779469..1782000
Genome map
AA seq 843 aa AA seqDB search
MGRNDPLAAYNAKRDFARTAEPAGKRKSSATGNLFIVQKHDATRLHWDFRMEVDGVLKSW
AVTRGPSPDPDDKRLAVQTEDHPLEYARFEGIIPEGEYGGGTVMLWDKGTWEPVEGKSAK
DLEKGHLHFRLEGERMKGEWLLVRLKRRGNEKRDNWLLRKLDDAYAGQGDQLVERGLTSV
LTGRTMAEIASDKAGSHSLKGKRGKAFASVMEEAGTHNRKVGKARGKAPSRARRNAPLPA
FQPVQLATLVDTVPDGRQWLYEIKFDGYRALVAVRGTEVRVFTRSGLDWTEKFAPLARHL
AGLKLPSCLIDGEIVAADADGNPDFSRLQAVLKRGHGEQGEGDALSFHAFDLLELEGEDL
KPLPNVERKQKLAALLAGVSPPIHVADHIIGGGEKLLGALCGAGQEGIICKRADAAYAGK
RTQNWLKVKCVARQEFIVVGFTRSSARRRPFASLLLAQREGKALVYKGKVGTGFDEDLLQ
DLATRFEALKVDEGPLDVPITEARGVTWLKPELVAEIAFAEFTAEGRVRHASFVGLREDK
KAADVVPERPAPLVVQPEIVPISNRERVIFPESGQTKGDLADYYAAMAPAMLPFIANRPV
SLVRCPQGRARHCFFQKHDSGSFGEHVHHVPIREKDGNEEEYLFVSDAAGILSCVQMGTI
EFHGWCSLASDVEAPERMVIDLDPDEGLDFNDVKRAARDIRDRLSDLGLVSFAMLSGGKG
VHVVVPLRPDHTWEAHASFAERFARALALAEPDRYVATMSKARRKGRIFIDWLRNRRGST
AVMPYSARARANAPVAVPIAWEELDDFANAHPFCIGDTAGLLKRSEGKSLRGWGMAQQSL
PDV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcaacgatccgctcgccgcctacaacgccaagcgcgacttcgcgcgcactgcg
gaacctgccggcaagcgcaagtccagcgccacgggcaatctcttcatcgtccagaagcac
gacgccacccgcctgcactgggacttccgcatggaggttgatggcgtgctcaagagttgg
gccgtgacccggggccctagccccgatcccgacgacaagcgcctcgctgtccagaccgag
gaccaccccctcgaatacgcccggttcgaaggcatcatccccgaaggcgagtacgggggc
ggcaccgtcatgctctgggacaagggcacctgggagccggtcgagggcaagagcgccaag
gatctggaaaaggggcacctccatttccgcctcgagggggagcggatgaagggcgaatgg
ctgcttgtccgcctcaagcgtcgcggcaatgaaaagcgcgacaactggctcctgcgcaag
ctggacgacgcctatgcgggccagggcgaccagctcgtcgagcgcggcctgaccagcgtc
ctcaccggccgcaccatggccgaaatcgcctccgacaaggctggcagccattcgctcaaa
ggcaagcgcggcaaggccttcgcttcggtgatggaagaagcaggcacgcataaccgcaag
gtcggcaaggcgcgcggcaaggcaccgtccagggcgcgccggaacgcaccgctacccgcc
ttccagcccgtccagctcgcaaccctggtcgatacggtgcccgatgggcgccaatggctg
tacgagatcaagttcgacggctaccgcgcgctcgtcgcagtgcggggaaccgaggtccgc
gtcttcacccgcagcggtctcgactggaccgaaaagttcgcgccgcttgcccgccatctc
gccgggctcaagctgccgtcgtgcctgatcgacggcgagatcgtcgccgccgatgccgat
ggcaatcccgatttctcgcggcttcaagccgtgctcaagcgcgggcatggcgaacagggc
gagggtgatgccttgtcgttccacgccttcgacttgctggaactcgaaggcgaagacctg
aagcccctgcccaatgtagagcgcaagcagaagctcgccgcgctgcttgccggggtctcg
ccgccgatccacgtcgccgaccacatcatcggcggcggcgaaaagctgcttggcgcgctg
tgcggcgcggggcaggaagggatcatctgcaagcgcgcggacgcggcctatgcgggcaag
cggacgcagaactggctgaaggtgaagtgcgtggcccgccaggaattcatcgtcgtcggc
ttcacccggtccagcgcccgccgccgccctttcgcctcgcttctcctggcccagcgcgag
ggaaaggcgctggtctacaagggcaaggtgggcaccggctttgacgaggacctgctgcaa
gacctcgccacccggttcgaagccctcaaggtcgacgaaggtccgctcgatgtgcccata
accgaagcgcgcggcgtgacctggctgaaacccgaactcgtcgcggaaatcgcctttgcc
gaatttaccgccgaaggccgtgtccgccacgccagcttcgtcggtctgcgcgaagacaag
aaggccgcggacgtcgtccccgaacggcccgccccgctggtcgttcagccggaaatcgtg
ccgatcagcaatcgcgagcgggtgatctttcccgaaagcggccagaccaagggcgacctt
gccgattactacgccgcgatggcgcccgcgatgctcccgttcatcgccaaccgccccgtc
agcctcgtccgctgtcctcaggggcgcgcgcgccactgcttcttccagaagcacgatagc
ggctcgttcggcgaacacgtccaccacgttccgatccgcgagaaggatggcaacgaggag
gagtatctgttcgtcagtgacgccgccggcattctctcgtgcgtgcagatgggcacgatc
gagttccacggctggtgttctctggcaagcgatgtcgaggcgcccgaacggatggtcatc
gacctcgatcccgacgaggggctcgatttcaacgacgtcaagcgcgccgcccgcgatatt
cgtgaccgcctgtccgacctcggtctcgtcagctttgccatgctttccggcggcaagggc
gttcacgtcgtcgtgccgctgcggcccgaccacacctgggaggctcacgccagctttgcc
gaacgttttgcccgcgcgctcgccctggcggaacccgatcgctacgtcgcaacgatgagc
aaggccaggcgcaagggccgcatcttcatcgactggctccgcaaccggcgcggcagcacc
gctgtcatgccctattcggcgcgcgcccgcgccaacgctcccgtcgcggtgccgatcgcc
tgggaggaactcgacgacttcgcgaacgcccaccccttctgcatcggcgatacggcagga
ctactcaagcgtagcgaaggcaagtcgctgcgcggctggggaatggcccaacagtccctc
ccggacgtttag

DBGET integrated database retrieval system