KEGG   Novosphingobium aromaticivorans: Saro_1699Help
Entry
Saro_1699         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1784178..1785101
Genome map
AA seq 307 aa AA seqDB search
MEATSDRTDVMLADARRLEQEGRHDEAFASFVAAKAALRATTDYDFAAEEALFEALRRAF
ARELPLAGASTVTAAPLFVVGLPCTGTALLESIVAAHPAVASRAAPGAVVGALRQSTETE
AGLPIDTAAIARLAGRSADTLGRSYLARAGAMPGARFVDGEAMNFLYVGAIAQALPRASI
VCVQRGAMDSVWRIFTQRPSSVGQGLEWSNSLMETAQYVLLFQRLEAFWRQRLPGRIHEL
SYEQFLADRDVQTRRMLAHCGLQPDPACLAAAASTQSDEGPMGAWRPYEAHLGEVADFFI
ANGIPID
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcgacgagcgacaggaccgacgtcatgctggcggatgcccggcgcctcgagcag
gagggacgtcacgacgaagcctttgccagcttcgtcgccgcaaaggcggccttgcgcgcc
actaccgactacgattttgctgccgaggaagcgctgttcgaagcgctgcgccgcgccttc
gctcgcgaactgccgctcgcgggcgccagcacggtcaccgccgcgccgctcttcgtcgtc
ggcctgccttgcaccggcaccgccctcctcgaaagcatcgtcgccgcccatccggccgtc
gcgtcccgcgccgcgccgggagcagtggtgggtgccctgcgacaatccaccgagacggaa
gctggcttgccaatcgatactgcggccattgcccgcctcgccggaaggtcggccgacacg
ttgggccgcagctacctcgcgcgcgccggcgcgatgccgggcgcccgtttcgtcgatggc
gaggcgatgaatttcctttacgtcggtgccattgcccaggccttgccgcgagcctccatc
gtctgcgtccagcggggggcgatggacagcgtatggcgcatcttcacccagcgcccttcg
tcggtggggcagggtctggaatggtcgaacagtctaatggaaacagcgcaatacgtgctg
ctcttccagcgacttgaagcgttctggcggcagcgccttcccggccgtattcatgaactg
tcctacgagcagttccttgccgatcgcgatgtgcagacgcgccggatgctggcccattgc
gggctccagcccgatcccgcgtgccttgctgccgccgcatccacgcagagcgacgagggg
ccgatgggggcttggcgcccctatgaagcgcaccttggcgaagttgcggacttcttcatc
gccaacggcatccccatcgattga

DBGET integrated database retrieval system