KEGG   Novosphingobium aromaticivorans: Saro_1704Help
Entry
Saro_1704         CDS       T00322                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1789351..1790208
Genome map
AA seq 285 aa AA seqDB search
MILFAGARPGRCHARARNGLNLDRHQGMVKRLVAARQPIGEARREMRLAPREDWCYARAM
AARPDTTQTDLPSARRPGTYVRGTETVDAILKAALSVLIEEGAGAFTVRRIAAECGMKVG
NVSYHFPKKELLIQTLLDDIIANYDKLLERTVRQPGLDAEERLRLIVVMCLDDIAGKRTT
RLFTELWALANHNEFVADRVRLFYQRVHEFIAEYVRELNPALGEQEVRDVALFISASMEG
ATPFLGYEKPWAQRMQAFTAIAAHSLVHLAKTVTSVEIAGLVDRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgattttgttcgctggggcccggcctggcaggtgccatgcccgagcccgcaatggtctg
aatctggacaggcatcaaggcatggtcaagcgccttgttgcagcgcgtcaaccgatcggt
gaagcccggcgggaaatgcggttggcgccgcgcgaggactggtgttatgcgcgagccatg
gctgcccgcccggatacgacacagaccgatctgccctctgcccggcgtcctggcacttat
gtgcgcggaaccgaaacggtggacgccattctgaaggccgcgctcagcgtgctgatcgag
gaaggggccggggcgtttaccgtgcgccggatcgcggccgaatgcgggatgaaggtcggc
aacgtcagctaccacttccccaagaaggaactgctgatccagaccctgctggacgacatc
attgcgaactacgacaagttgctggagaggaccgtgcgccagccggggctcgatgccgag
gagcggctgcgcctgatcgtggtcatgtgtctcgacgatatcgccggcaagcggacgaca
cgccttttcacagagctgtgggcgctggccaaccacaacgagttcgtcgccgaccgggtt
cggctgttctatcagcgcgtgcacgagttcatcgcggaatatgtgcgcgaactgaacccg
gcattgggcgagcaggaagtgcgggacgtggccctgttcatcagcgcgtcgatggaaggg
gcaacgccgtttctcggctacgagaaaccgtgggcgcagcggatgcaggcgttcaccgca
attgccgcgcattcgcttgtccacctggcaaagaccgtgacttcggtcgagatcgccggg
ttggtcgacaggagatag

DBGET integrated database retrieval system