KEGG   Novosphingobium aromaticivorans: Saro_1708Help
Entry
Saro_1708         CDS       T00322                                 

Definition
(GenBank) TonB-dependent receptor
  KO
K02014  
iron complex outermembrane recepter protein
Organism
nar  Novosphingobium aromaticivorans
Brite
Transporters [BR:nar02000]
 Other Transporters
  Pores ion channels [TC:1]
   Saro_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1793755..1796181
Genome map
AA seq 808 aa AA seqDB search
MNFRVLLAGGAAPLALIAPGAFAAEAPVEAVPTATAPVDAPADAQVSSAGTGANDSGDIV
VTARRRAETAQDVPLAISVVGGEHIDSTGSFNVGRLQQLTPTLQFYSSNPRNTAVNIRGL
GVPFGLTNDGIEQGVGIYVDDVYNSRVASATFDFLDVKQIEVLRGPQGTLYGKNTTAGAI
NITTNQPTFDFEGKAEVSVGNLNFVQAKGAISGPITDTLAARFAVSSTSRRGTIYNVTTN
QWIQSQDNLGLRGQLLFKPSEAFSITLAGDYSEQDAVCCGSVYVRTGTTQRATNRQFAAL
AAAQGYTVPSTNPFDRLTDLDSALQAGNKIGGVSLKVKWDVGPGTLTSVTAWRFWDWKPQ
NDRDFTGLPIVAKSQNPSQQDQYTQELRYNYSGDSLDFVLGAFGFYQRIDTQGTEAHGSA
STKWNVNPSSSLYNTQVLDGLTALNTQYLKNTSLAVFGQASWKVTPELTLQPGIRVNYDK
KDGFYQRRVFTGAGTEILLDGTTSATKTAQLAIFTPQTISPSFSDWNFSYDFTASYKVAR
GVLVYATYAKTFKSGGINQNGVPVDASNNPILAAATVKPESVQHYEAGIKTEFWDRRAIF
NLSAFRTDIKDYQANVNNGQFGVLRGYLANAGAVRSQGIEADFSVRPSERFNAYVNSAYT
DATYRKFVDAPCPPELSGGTSSPANCDISGQRLPGVSKWSFSFGFEANAPVEFLKQDGQV
YLGYDGSYRSDFSSNPTPSAYTWIDGYSLSNFRLGFRTDAGLDVYGWVRNAFDQDYFEQL
FVGPGNTGLIAGLPGDPRTWGFTVRTNF
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccgcgtccttctcgcgggcggcgccgctccgctcgccctcatcgcgcctggc
gccttcgccgccgaagcgcctgttgaagccgtccccaccgctaccgcgcctgtagatgcc
cctgccgatgcgcaggtctcgtcggccggcaccggagccaatgacagcggcgatatcgtc
gtcaccgctcgccgccgcgccgaaaccgcgcaggacgtgccgctggccatctcggtcgtg
ggtggcgagcatatcgacagcaccggcagtttcaacgtcggccgcctccagcagttgacc
ccgacgttgcagttctattcgtcgaacccgcgcaacaccgccgtgaacatccgcggcctt
ggcgtgccgttcggcctgaccaacgacgggatcgagcagggcgtcggcatctatgtggac
gacgtctacaactcgcgcgtggcatcggcgacgttcgacttcctcgacgtgaagcagatc
gaagtcctgcgcgggccgcagggcacgctctacggcaagaacactaccgccggcgcgatc
aacatcaccaccaaccagccgaccttcgacttcgaaggcaaggccgaggtgagcgtgggg
aacctcaacttcgtgcaggccaagggcgcgatttccgggccgatcaccgatacgctggcc
gcgcgcttcgcggtttcgtcgaccagccggcgcggcacgatctacaacgtgaccaccaac
cagtggatccagagccaggataacctgggcctgcgcggccagctcctgttcaagccaagc
gaggccttcagcatcacgcttgccggcgactacagcgagcaggatgcggtgtgctgcggt
tcggtctacgtccgcaccggcaccacccagcgcgcgacgaaccgccagtttgccgcgctc
gcggcggcgcagggctataccgtgcccagcaccaatcccttcgaccgcctgaccgacctc
gattccgcgctccaggcgggcaacaagatcggcggcgtttcgctgaaggtgaagtgggac
gtgggaccgggtacgctgacttcggtcaccgcctggcgcttctgggactggaagccgcag
aacgaccgtgacttcaccggcctgcctatcgtggcgaagtcgcagaacccgtcgcagcag
gaccagtacacgcaggaactgcgctacaactatagcggcgacagcctcgacttcgtgctc
ggcgcgttcggcttctaccagcgcatcgacacccagggcaccgaagctcacggcagtgct
tcgaccaagtggaacgtgaacccgtccagttcgctctacaacacgcaggtcctcgacggg
ctgaccgcgctcaacacgcagtacctcaagaacacgagccttgccgtgttcgggcaggca
agctggaaggtgaccccggaactgacgctgcaaccgggcatccgcgtgaactacgacaag
aaggacggcttctaccagcgccgggtgttcactggcgccggcaccgagatccttctcgac
ggtacaaccagcgccaccaagaccgcgcagctggcgatcttcacgccgcagacgatctcg
cccagcttcagcgactggaacttcagctacgactttaccgcgagctacaaggtggcgaga
ggcgtgctggtctatgcaacttacgccaagaccttcaagtcgggcggcatcaaccagaac
ggcgtgccggtggatgcgtcgaacaacccgatcctggcggcggcgacggtgaagccggaa
tcggtccagcattacgaggcgggcatcaagaccgagttctgggatcgccgcgcgatcttc
aacctttcggccttccgcaccgacatcaaggactaccaggccaacgtcaacaacggacag
ttcggtgtgctgcgcggttacctggcgaatgccggggcggttcgttcgcagggtatcgag
gccgacttctcggtccgtccgagcgaacggttcaacgcctacgtgaacagcgcctacacc
gacgcgacctatcgcaagttcgtcgatgccccgtgcccgccagagctttccggcggcacc
agcagcccggccaactgcgacatttcgggccagcgcctgccgggcgtttcgaagtggtcg
ttctctttcgggttcgaggccaatgcgccggtcgagttcctgaagcaggacgggcaggtc
tacttggggtacgacggaagctatcggtcggacttctcgtccaacccgacgccttcggcc
tatacctggatcgatggctattcgctgtcgaacttccggctgggcttccggaccgacgcg
ggcctggacgtctatggctgggttcgcaacgccttcgaccaggactacttcgagcagctc
ttcgtcggcccgggcaataccggcctgatcgcgggcctgccgggcgatccgaggacctgg
ggcttcaccgtccgcacgaacttctga

DBGET integrated database retrieval system