KEGG   Novosphingobium aromaticivorans: Saro_1709Help
Entry
Saro_1709         CDS       T00322                                 

Definition
(GenBank) protein of unknown function DUF124
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1796243..1797076)
Genome map
AA seq 277 aa AA seqDB search
MANSPWQHHRSTSIADDIDFEIKGQELQFLEIELDPGESAVAEAGALVWKDGAVGMTTVF
GDGSGGSEGGFMGKLLGAGKRLVTGESLFTTVFTHNGHGKARVAFASPTPGAILPIKLSD
VGGTLICQKDSFLAAARGVSIGIAFQRRVMTGLFGGEGFIMQKLEGDGWVFVQMGGTLVE
KELRSGEELHVDTGCLAAYTPSIDFDLVTAGGVRSVLFGGEGLFFARLRGPGKVWIQSLP
FSRLAGRMLAAAGSSGGQNRGEGSILGGLGDFIGGNN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaacagcccctggcagcaccaccgcagcaccagcatcgccgacgacatcgacttc
gagatcaaggggcaggaactccagttcctcgaaatcgagctggaccccggcgaaagcgcc
gttgccgaagcgggtgcgctggtctggaaggacggggctgtcggcatgacgacggtcttc
ggcgatggcagcggcggcagcgaaggcggcttcatgggcaagctgcttggcgcgggcaag
cggctggtaaccggcgagagcctgttcaccaccgtctttacccataacggccacggcaag
gcccgcgtcgccttcgcctcgcccacgcccggcgcgatcctgccgatcaagctttcggac
gttggcggcacgctgatctgccagaaggacagcttcctcgccgccgcgcgcggggtttcc
atcggcatcgccttccagcgccgggtgatgaccggcctgttcggcggcgaaggcttcatc
atgcagaagctcgaaggcgatggctgggtcttcgtccagatgggcggcacccttgtcgaa
aaggaactgcgatccggcgaggaactgcacgtcgataccgggtgccttgccgcctatacc
ccgtcgatcgatttcgaccttgtgaccgccggcggcgtccgttcggtcctgttcggcggc
gaaggactgttcttcgcgcggctgcgcggtccgggaaaggtctggatccagtccctgccc
ttctcgcgccttgccggccggatgcttgcggcagccggatcgagcggcggccagaaccgc
ggcgaaggctcgatccttggcggattgggcgacttcatcggcggcaacaactga

DBGET integrated database retrieval system