KEGG   Novosphingobium aromaticivorans: Saro_1716Help
Entry
Saro_1716         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1804405..1804659)
Genome map
AA seq 84 aa AA seqDB search
MNGTIEAPEWRTYRAERSAAGAGCPCKGVSVRDGSHSGVPSGFDQNGHLPRQSGLKYRHI
PAPSFLAPGRFASNLDGAIHEFTA
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaccatcgaggcgccggaatggcgaacatatcgggccgaaaggtccgccgca
ggggctggttgcccctgcaagggcgtttcggttcgagatggaagccattccggcgtcccg
tcgggatttgaccaaaacggccatctgccgcgtcagtcgggcttgaaatatcgacatatt
cctgcgccctccttccttgcacctggccgttttgcctcaaacctcgatggcgccattcat
gagtttacggcctag

DBGET integrated database retrieval system