KEGG   Novosphingobium aromaticivorans: Saro_1719Help
Entry
Saro_1719         CDS       T00322                                 

Definition
(GenBank) glycoside hydrolase, family 3-like protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ABD26159
UniProt: Q2G7L4
Position
1807270..1809192
Genome map
AA seq 640 aa AA seqDB search
MGGLKISAPMVLLAGVGAVALGASASARPAFRDLNHNGRLDPYENVALPVERRLDDLLKR
MTLEEKVALMLHGTLQAEGGRGIGVGNAYDTALAQELLARGVNSFITRIAPEPRAFATQN
NAIQRLAEATRLGIPATISTDPRNHFQVVVGASSDASGFSKWPETLGMAAIGDEKLVERF
GRLVAAEYRAVGIQMALSPQADLYTEPRWPRGNATFGSDPATVSRLAGAYVRGFQGGADG
LVRSGVATVVKHWVGYGAEPEGFDGHNYYGRIARLDNESFAQHVAAFEGALAAKSAGVMP
TYVIAEGVSIDGKPLPQVGAGFSKPLIEGLLRGTHKFGGIVISDWGITNTCPEQCSNPTA
EKPQGFAIAMPWGVEGLSEEDRYALGANAGIDQFGGVDNPGPLLAAVRAGKVSPARVDQA
ARRVLRLKFELGLFDDPYVDVEKAAQIVGNKATQAEADAAQRAAQVLLLNRNALLPLAPG
RKVWLSGVDASAARAAGLVVVDTAEQAEVAIVRVATPHEVLHPHHFFGSRQNEGRLDFRA
GDEATRTIAAAAARIPTVVAVDLDRPAVLTEVKDKATALFGLFGASDAVLLDLVTGKARP
AGKLPFELPSSAKAVEDQHPGRPDDSANPLFRRGDGLTYP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcttgaagatttctgcaccaatggtgctgcttgccggtgtcggggcggtcgcg
ctgggggcatccgcgtcggcaaggcccgcctttcgcgacctgaaccacaatggccggctc
gatccatacgagaacgtcgcgctgccggtcgaacggcggctcgacgatctgctcaagcgg
atgacgctggaggaaaaggtcgcgctcatgctccacggaacgcttcaggccgaaggcgga
cgcggcatcggggtgggcaatgcctacgacacggcccttgcgcaggaactccttgcgcgc
ggggtcaacagtttcatcacccgcatcgcacccgaaccccgcgccttcgcgacgcagaac
aatgcgatccagcggcttgccgaggcgacccggctcggcattcccgccacgatcagcacc
gatccgcgcaatcacttccaggtagtggtcggcgcaagcagcgatgccagcggcttctcc
aaatggcccgagacgctcggcatggccgccatcggcgacgagaagctggttgagcggttc
ggccgactggtcgccgccgaatatcgcgccgtcggcatccagatggccctgtcgccacag
gccgacctctataccgagccacgctggccgcgcggcaacgcgacgttcggctcggacccg
gccacggtctcgcgtcttgccggtgcatatgtgcgcgggttccagggcggcgcggacgga
ctcgtccgctctggcgtcgcgaccgtggtcaagcactgggtcggctatggcgccgagccc
gagggctttgacggccacaactattacggccgcatcgcccgtctcgacaacgaaagcttc
gcccagcacgttgccgctttcgaaggcgcgctcgccgcgaagtcggcaggcgtaatgccc
acctatgtcatcgcggagggcgtgagcatcgatggcaagccgctgccgcaggtcggcgcg
ggcttcagcaagcctctgatcgagggacttctgcgcggcacccacaagttcggcggcatc
gtcatttccgactggggcatcaccaacacctgccccgaacagtgcagcaacccgacggcc
gaaaagccccagggctttgcgatcgcgatgccgtggggcgtcgagggtctgtccgaggaa
gaccgctacgcgctgggcgcgaatgccgggatcgaccagttcggcggcgtcgacaatcca
ggccctctgcttgccgccgtccgtgccgggaaggtttcgcccgcccgggtcgatcaggcc
gcccgccgcgtgcttcgcctgaagttcgagcttggcctgttcgacgatccctatgtcgac
gtcgagaaggcagcgcagatcgtcggcaacaaggcgacgcaggccgaggccgatgcagcc
cagcgcgccgcgcaggtgctgctgttgaaccgcaacgcgcttctgccgctcgcgccgggc
cgaaaggtttggctctccggtgtcgacgccagtgccgcgcgtgctgccgggctggtcgtg
gtggacaccgccgaacaggccgaggtggccatcgttcgcgttgccaccccgcacgaagtc
cttcatcctcaccacttcttcggctcgcgccagaacgagggccgcctcgacttccgtgct
ggagacgaggcgaccagaaccatcgccgctgccgctgcgcgcatcccgaccgttgtggcc
gtcgacctcgatcgtcctgccgtgctgaccgaggtgaaggacaaggctaccgcgctcttc
ggcctgttcggcgccagcgatgccgtgttgctggatctcgtcaccggcaaggcccggccg
gcgggcaagctgccgttcgaactgccgtcctcggcaaaggcggtcgaggatcagcatccg
ggccgaccggacgacagcgccaacccgctcttccggcgcggtgacgggctgacctatccc
tga

DBGET integrated database retrieval system