KEGG   Novosphingobium aromaticivorans: Saro_1720Help
Entry
Saro_1720         CDS       T00322                                 

Definition
(GenBank) ATPase
  KO
K06915  
uncharacterized protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1809217..1810731
Genome map
AA seq 504 aa AA seqDB search
MAPALPTLVRFARATGVSASIVIGADRSGAPVRIDVEELLATRLLVQGNSGSGKSHLLRR
LLEESASIVQQVVIDPEGDFVTLAEPFGHVVVDGSAYDGAEIAKLAARIRKHRASVILAL
DGLELEAQMRCAAVFLNTLFDAPRDEWYPALVVVDEAQMFAPAAAGDVSDEVRRLSLSAM
TNLMCRGRKRGLAGVIATQRLAKLAKNVAAEASNFLMGRTFLDIDMARAADLLGMERRQA
EAIRDLERGHFLGLGPAIARRPVGVRIADVQTHARNVVQGLMPLPNAAGAEMESILLSEP
LAMEPPPRAPEPEAPPVESGELLEQIEGFVPAAEQVEPPVAPSLFEAEETAASIAGILAE
MAAEPDCTFQPASQLYQDFTVRCRMLRILPGMDLNAFRRRFAMAVAGIFDDKEPQWQDLL
RIGKDVPDDLLAPFLTLARAAVEGAPCPDDDRLAEIYGTRSSGRIRRLLEHLEKGNLIVV
RTDYGGRRSVGIPALGLTTAPVEA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccggccttgccgactctcgtgcgcttcgccagagcaaccggcgtgagcgcatca
atcgtcatcggcgccgaccggtccggcgcccctgtcaggatcgacgtcgaggagcttctt
gccacccgcctgctggtgcagggcaacagcgggtcgggcaagtcgcacctgctgcgccga
ttgctggaagaaagcgccagcatcgtccagcaggtggtgatcgaccccgagggcgatttc
gtgaccctcgccgaacctttcggccatgtcgtggtcgacggttcggcttatgacggcgct
gaaatcgccaagctggctgctcgcatccgcaagcatcgcgcctcggtcatcctcgcgctc
gacgggctcgaactggaagcgcagatgcgctgcgccgccgtgttcctcaacaccctgttc
gatgccccgcgcgacgaatggtatccggcgctggtcgtggtcgacgaagcgcagatgttc
gcccctgccgctgccggcgacgtttccgacgaagtgcgcaggctcagcctctcggccatg
accaatctcatgtgccgtgggcgaaagcgcgggctggccggcgtgatcgccacgcagcgc
ctggccaagctggccaagaacgtcgccgccgaagcgtccaacttcctgatgggccgcact
tttctcgatatcgacatggcccgcgccgccgaccttctcggcatggagcggcgccaggcc
gaagcgatccgcgatctggagcgcgggcatttcctcggcctgggccccgccattgcccgc
cgccccgtcggcgttcgcatcgcggacgtccagacgcatgcccgaaacgtggtgcaaggg
ctgatgccgctgcccaatgcggcaggcgcagagatggaatcgatcctcctgtccgaaccg
ctggcgatggaacctccaccccgcgcgccggaaccggaagcgccgccggttgagagcggc
gaattgctcgaacagatcgaaggcttcgtgcccgcagccgaacaggtcgagccgccggtc
gctccgagcctgttcgaagccgaggaaaccgcggcgagcatagcgggcattcttgccgaa
atggcggccgagcccgattgcacgttccagccggcctcgcagctctaccaggacttcacc
gtccgctgccgcatgctgcgcatcctgccgggaatggacctcaacgccttccgtcgccgc
ttcgcgatggcggtcgcgggcatcttcgacgacaaggagccgcagtggcaggacctcctg
cgcatcggcaaggacgtgccggacgacctgctcgcgccgttcctgacgctcgcccgcgcg
gcggttgagggcgcgccctgtcccgatgacgaccgtctggccgagatttacggcacccgt
tcgtctggccggattcgtcggctgctggaacacctcgagaagggcaacctcatcgtcgtg
cgcaccgattacggcgggcggcgttcggtcggcattccggcgcttgggctgaccacggcg
ccggtggaagcctga

DBGET integrated database retrieval system