KEGG   Novosphingobium aromaticivorans: Saro_1724Help
Entry
Saro_1724         CDS       T00322                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1812584..1814701
Genome map
AA seq 705 aa AA seqDB search
MNAQTETLIAAAAIPFAVPTSRWDDAVAAKLGPAELLLYRSNLLGSDLTVTNFGGGNTSA
KLEEMDPLTGEPVEVLWVKGSGGDIGSMKIDGFATLYQAKLLGLEAHYAGPQDDDKMVGF
LPHCTFNLNCRAASIDTPLHSLLPFAHVDHVHPDAIIALAASSGGEAATKEIWGGRIGWL
PWKRPGYTLGVMLRDFVKANPGVEGVMLAGHGIICWADSAKACYEHTVRLIADAAGYLNA
RLAEKPAFGGRKVAPNPDRAKIAADLMPRLRGFMTGARNKLGHFSDDAEALEFVGSVDFE
RLAALGTSCPDHFLRTKIAPLTLDPSRLQDDDYLARKIAGYRDLYAAYYERCKRPNSPAM
RDSNPVVVLVPGVGRITFATDKTTARLAGEFYGNAINVMRGAEAIGDYIALDEQEAFDIE
YWLLEEAKLQRMPAPRPLVGKIALVTGGAGGIGAASAARLLREGACVVLADRAADAVEDV
RAGFARQFGNDVVRAAVCDVTDEAQVQAAFDVAAREFGGLDILVANAGIASSAPLEETTV
DLWNRNYDVLAQGYFLTSRSAWPLMKRMKEQGGASVVFIGSKNGVAAATNASAYASAKAA
ANHLARCLALEGAPFGIRVNTVNPDAVIKGSKIWDGDWRKERAGAHGIDSGKELEEHYRQ
RSMLKRDVLPEDIAEAVYFLASDMSAKSTGNMINVDAGNAQAFTR
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcagaccgagaccttgattgccgctgccgccattccgttcgcggttccgacc
agccgttgggacgatgccgtcgcggcaaagctcggcccggcagaacttctgctctatcgc
tcgaacctgctcggttccgatcttaccgtcaccaacttcggtggcggcaatacgtcggcc
aagcttgaagagatggatccgctgactggtgagccggtcgaagtgctgtgggtcaagggt
tcgggcggtgacatcggctctatgaagatcgacggctttgccactctttaccaggcaaag
ctgcttggcctcgaggcgcactatgccgggccgcaggacgacgacaagatggtcggcttc
ctgccgcactgcacgttcaacctcaactgtcgcgcggccagcattgatacgccgctgcac
tcgctgctgcccttcgcgcatgtcgatcacgtccatcccgatgcgatcatcgcgctggcc
gcttcctcggggggcgaggccgccacgaaggaaatctggggcggccggatcggctggctg
ccgtggaagcgtcccggctacacccttggcgtgatgctccgcgatttcgtcaaggctaac
ccgggcgtcgaaggtgtcatgcttgccggccatggcatcatctgctgggccgacagcgcc
aaggcctgctatgaacataccgttcggctgatcgcggacgcggccggctatctcaatgcc
cggctcgccgaaaagccagcgttcggaggtcggaaagtggcgccgaacccggatcgggca
aagatcgccgccgacctcatgcctcgcctgcgtggcttcatgaccggtgcgcgcaacaag
cttgggcacttctcggacgatgccgaggcgctggagttcgttggctcggtggacttcgag
cgtctcgccgcgcttggcacctcgtgccccgaccatttcctgcgcaccaagatcgcgccg
ctgacgctcgatccctcgcggctgcaagacgacgactacctcgcgcggaagattgccggc
tatcgcgatctctatgcggcctattatgaacgctgcaagcgcccgaactcgccggcaatg
cgcgattccaaccctgtcgtcgtgctcgtcccgggcgtcggacgcatcacgttcgccacc
gacaagaccaccgcgcggctcgctggcgaattctacggcaacgccatcaacgtgatgcgc
ggggccgaagccatcggcgattacattgcgctcgatgagcaggaagccttcgacatcgaa
tactggctgctcgaagaggccaagctccagcgcatgcctgcgccccggcctctggtcggc
aagatcgcgctggtcaccggcggggcagggggcatcggcgcggcatcggccgcccgcctg
ctgcgcgaaggcgcctgcgtcgtgctggccgatcgtgccgccgacgcggtcgaggacgtc
cgcgccggtttcgcaaggcagttcggcaacgacgtcgtgcgcgcggccgtctgcgacgtg
accgacgaggcgcaggtccaggctgctttcgacgtggccgcacgtgaatttggcgggctc
gacattctggtcgccaacgccggcatcgcatcttctgcaccgctcgaggaaacgaccgtc
gatctgtggaaccgcaactacgacgtcctcgcgcaggggtatttcctgacctcccgctcc
gcctggccgctcatgaagcgcatgaaggagcagggcggcgcgtctgtcgtgttcatcggt
tccaagaacggcgttgccgccgctacgaacgccagtgcctatgcttccgcgaaggctgcc
gcgaaccatctcgcgcggtgcctcgcgcttgaaggcgcgccgttcggcatccgcgtcaat
accgtcaaccccgatgccgtcatcaagggcagcaagatctgggacggcgactggcgcaag
gaacgcgccggggcccacggcatcgacagcggcaaggaactggaagagcactaccgccag
cgctcgatgctcaagcgcgatgttctgcccgaagatatcgcggaagcagtctatttcctc
gcttcggacatgtcggcaaaatccaccggcaacatgatcaacgttgatgcggggaacgcc
caggccttcactcgctga

DBGET integrated database retrieval system