KEGG   Novosphingobium aromaticivorans: Saro_1725Help
Entry
Saro_1725         CDS       T00322                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1814724..1815650
Genome map
AA seq 308 aa AA seqDB search
MKKAAYLFALAASVQVVPAIAQDGPPPLAPASAPVEPDAVPLYGAQTPGSASSEQWVKFG
GRDYAVRNVTRPTITPVLPDPAKATGAAVVVAPGGAFMMLAMDHEGWKVARALADRGIAA
FVLKYRLNPTPRDEAEAGRYMNEQLGREVGHPMTGDLLGKSMAPADGKAAIAWVRTNAAR
FGIDPARVGMIGFSAGAMTTRRVGLDGDAATRPAFLGYIYGPQDAEPVPADAPPMFDAIA
LDDALFPSKGFPIAQAWLDARRPVEIHGYQKGNHGFGLGLPGTTTTLLIDQFTAWLQMQG
FLARKDSK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcggcatatcttttcgcgttggcggcgagcgttcaggtggttccggccatc
gcgcaggacggtccgccgcctctcgcgccagcgtccgccccggtcgagccggacgccgtt
ccgctctacggtgcgcagacgccgggcagcgcttcgagcgagcagtgggtcaagttcggc
gggcgcgactatgcggtccgcaacgtaacgcgcccgacgatcacgccggtcctgcccgat
ccggcgaaggcgacgggcgcggcggtcgtcgtcgcgcctggcggtgcgttcatgatgctg
gcgatggaccacgaaggctggaaggtcgcccgcgcccttgccgaccgaggcatcgccgcg
ttcgtgctcaagtaccgtctcaacccgacgccgagggacgaggccgaagcgggccggtac
atgaacgagcaactcggcagggaagtcggccatccgatgaccggcgaccttctcggcaag
tcgatggcccctgctgacggcaaggccgccatcgcatgggtccggaccaacgccgcgcgc
ttcggcatcgatcccgcacgcgtcggcatgatcggtttctctgctggtgccatgaccacg
cgccgcgtgggcctggacggcgacgccgccacgcgtcctgcattcctcggctatatctat
ggcccgcaggacgccgagccggtgcctgccgatgcgccaccgatgttcgatgccatcgct
ctcgacgatgcgctcttcccgtcgaagggctttcccatcgcccaggcctggctcgatgcc
aggcgtccggtcgagatccacggctaccagaagggcaaccacggcttcggccttggcctg
cccggcaccaccaccaccctcctgatcgaccagttcaccgcgtggctccagatgcagggc
ttcctcgcgcgaaaggacagcaagtga

DBGET integrated database retrieval system