KEGG   Novosphingobium aromaticivorans: Saro_1727Help
Entry
Saro_1727         CDS       T00322                                 

Definition
(GenBank) glycoside hydrolase family 2, sugar binding protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1816983..1820396
Genome map
AA seq 1137 aa AA seqDB search
MNIRNGLSVATLLASTTVLTPAALADTAPAVQAAPAASTLDQQFQDPPMEARPRVWWHWM
NGNITKDGIAKDLAWMKRVGIGGLQNFDAGLDTPQVVDKRLVYMTPEWKDAFRFAAIEAD
RLGLELAIAASPGWSETGGPWVKAEDGLKKVVWSETVLKGGKRFSGKLPLPPAETGPFLD
MPESDPLAAIVGDHGFKAPALYSDVAVLAVPDLGKPLPVPAYSAGGKSLDAAALSDGSLK
TGVTLARGPVDAPTTIVAAYGAPQTVRSATVSIPGAKGTFSGPTVQMHLEASDDGQAWRK
VADFPVTAAPSTVGFPAVTARQFRLVLAPLPFNGSNMGDPMPGLAPVGGFVEMMAAAAKA
PFDVKQFRLSSDVMVDQFESKAGFAVVPDYYALGTPDAAAAGIDPKQVIDLTGRMKPDGT
LDWTAPKGNWRIIRLGSSLLGTTNHPAPPEATGLEVDKFDGDAVRRYLEHYIGMYKDAAG
SELVGKRGVRAILTDSIEVGAANWTPRMVEQFKRLRGYDPTPWLPTLAGVLVGTRAQSDG
FLRDYRQTLADLMASEHYGTVARVAHENDLKVYGEALEDNRPSLGDDIAMRSHADVPMSA
LWTFSRKAGPNPSYIADMKGAASTAHIYGQNLVAAESMTSALAPWAYAPNELRRIIDLEF
ASGVNRPVVHTSVHQPVDDKVPGMSLMIFGQYFNRHEAWAELARPWVDYMARSSLLLQAG
RNVADVAYFYGEEGPLTALYGRKRIEDAPKVHAYDFINRDALFDAVEVQGGEVVAKGGAR
YKAIQLGGSSRRMTLPTLRRLAALVEAGATVVGSPPEGSPALNDSAADFSALVAKLWSGQ
LVTRVGAGQVIASADIDRALADAGIAPDLVLDGTSEDGEVLFVHRALPDGDAWFLNNRKA
APEVVEARFRVTGKQPELWHADTGETEAISYRIENGQTVVPLTLDAEDSVFVVFRKPASA
NSMAIKKGVPATVATLDGAWKVAFQPGRGAPASIALPRLGSLSDQADPGVKYFSGLATYT
STFTLPKGVKPGQPLWLNLGQVGEIAEVSVNGKHAGYAWHKPYRVNIGASARKGVNTLEV
KVANLWVNRLIGDAQPNASRITWTALPTYGPDAPLRPSGLIGPVTLEAIGAGVPSKP
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgcaacggcctttcggtcgcaacgctacttgccagcaccaccgtgctcacg
cccgctgcactcgcggataccgcacctgcggtgcaggccgccccggcggcatcgacactc
gaccagcagttccaggatccgccgatggaagcgcgcccgcgcgtctggtggcactggatg
aacggcaacatcaccaaggacggcattgccaaggaccttgcgtggatgaagcgcgtcggc
atcggcggcctccagaacttcgacgcggggctcgatacgccgcaagtggtcgacaagcgt
ctcgtctacatgacgcccgagtggaaggacgccttccgcttcgccgcgatcgaggcggac
cggctcggcctcgagctcgccatcgccgcatccccaggctggtcggaaaccggcggcccg
tgggtcaaggccgaggacggcctcaagaaggtcgtctggagcgagaccgtcctgaagggc
ggcaagcgcttttccggcaagctgccgctcccgccggccgagaccgggcctttcctcgac
atgccggaatccgatccgcttgccgccattgttggcgatcatggcttcaaggcgcccgca
ctatacagcgacgtggcggttctggccgttccggatctgggcaagccactgccggttccc
gcttattcggccggcggcaaatcgctcgatgcggcagcgctttctgatggcagtctcaag
accggcgtgacgctggcgcgcggtccggtcgatgcgcccacgaccatcgtcgccgcctat
ggcgcgccccagacggtccgctcggccaccgtctcgatcccgggcgccaagggcacgttc
tccggcccaaccgtacagatgcacctcgaagccagcgacgacgggcaggcgtggcgcaag
gtggccgatttcccggtgactgcggcgccttccacggtcggcttcccggccgtcaccgcc
cgccagttccgcctcgtccttgcgccactgccgttcaacgggtcgaacatgggcgatccg
atgccgggcctggctccggtcggcggcttcgtcgaaatgatggccgctgccgccaaggcc
cccttcgacgtcaagcagttccgcctttcgtccgatgtgatggtcgaccagttcgagagc
aaggccggctttgctgtcgtgcccgactactacgccctcggcacgccggacgccgccgcg
gcgggcatcgatccgaagcaggtgatcgacctgaccgggcgcatgaagccagatggcacg
ctcgactggacggcgcccaagggcaactggcggatcatccgtctcggctccagcctgctc
ggcacgaccaaccatcccgcgccgcccgaggcaaccggcctcgaagtcgacaagttcgac
ggcgatgcggttcgccgttaccttgaacactatatcggcatgtacaaggacgcggccggt
tcggaactcgtcggcaagcgcggcgtccgcgcgatcctgaccgattcgatcgaggtcggc
gcggccaactggaccccgcgcatggtcgagcaattcaagcgcctgcgcggctacgatccc
acgccctggctgcccacgcttgccggcgttcttgtcggtacgcgggcccagtccgacggg
ttcctgcgcgactatcgccagaccctggccgatctcatggcttccgaacactatggcacg
gttgccagggtcgcgcacgagaacgacctcaaggtctatggagaggcgctggaagacaat
cgtccgtcgcttggcgatgacatcgccatgcgcagccacgccgacgttccgatgtcggcg
ctgtggaccttctcccgcaaggcagggcccaatcccagctacattgccgacatgaagggt
gctgcctccaccgcccacatctacgggcagaacctcgtcgctgcggaatcgatgacttcc
gccctcgctccctgggcctatgcgcccaacgagttgcgccgcatcatcgacctcgaattt
gccagcggcgtgaaccgcccggtcgttcacacctcggtgcaccagcccgtcgacgacaag
gtgcccggcatgtcgctgatgatcttcgggcagtacttcaaccggcacgaagcctgggcc
gaactggcgcggccctgggtcgactacatggcccgttcgtcgctgttgcttcaggccggc
aggaacgtcgcggacgtggcgtacttctatggcgaggaagggccgctcaccgcgctctac
ggccgcaagcgcatcgaagatgcgccgaaggtgcacgcctatgacttcatcaaccgcgac
gccctgttcgatgcggtcgaagtgcagggaggcgaagtcgtcgcgaagggcggcgcgcgc
tacaaggcgatccagctcggcggctcgtcccggcgcatgaccttgccgacgttgcgtcgc
ctcgcggcgctggtcgaagctggcgcgaccgttgtcggcagcccgccggaaggttcaccc
gcgctcaacgacagcgcggccgacttctcggcgctcgtcgccaagctgtggagcggtcag
ctggtgacgagggtcggggcagggcaggtgattgcctctgccgacatcgaccgcgcgctt
gccgatgccggcattgcgccggacctggtgctcgatgggacgtcggaggacggcgaggtg
ctgttcgtccaccgcgccctgccggacggcgacgcatggttcctcaacaaccgcaaggca
gctccggaagtcgtcgaggcccgtttccgcgtaaccggcaagcaaccggaactgtggcac
gccgataccggcgagaccgaggccatctcctaccggatcgagaatggccagacggtcgta
ccgctgacgctcgatgccgaggattcggtcttcgtcgtgttccgcaagccggcctcggcc
aattccatggcgatcaagaagggcgttccagcgaccgtcgcgacgctcgatggtgcgtgg
aaggtcgccttccagcccggtcgcggcgcccctgcatccatcgctctgccaaggctgggt
tcactcagcgatcaggccgatccgggcgtgaagtacttctcgggtcttgccacctacacc
agcactttcacgctgccgaagggcgtgaagccgggccagccgctatggctgaacctcggc
caggtcggtgaaatcgccgaggtcagcgtcaacggcaagcatgccggatacgcctggcac
aagccctatcgcgtcaacatcggggcatcggcgcgcaagggcgtcaatacgctcgaagtg
aaggtcgccaacctttgggtcaatcgcctgatcggcgatgctcagcccaatgcgtcccgg
atcacctggacggcgctcccgacctatggccccgacgcgcctttgcggccctcgggcctg
atcgggccggtgacgcttgaagctattggggcgggggtgccgtcgaagccctga

DBGET integrated database retrieval system