KEGG   Novosphingobium aromaticivorans: Saro_1731Help
Entry
Saro_1731         CDS       T00322                                 

Definition
(GenBank) transcriptional regulator, BadM/Rrf2 family
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1825510..1825944
Genome map
AA seq 144 aa AA seqDB search
MLSQKTRYTIRALQHLADTWGQGAVRLDAIAEKQNIPRKFLTVILSEMAREGIVISHRGR
DGGYELALPPVDIRYGDIIRLTRGSLALVPCASRNAHEHCNNCLPEVDCRLRGLMLQLRD
ETAAILDRITLADPIAVEPPFAEA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgcaaaagacgcgatacacgatccgagccctgcaacatctcgccgatacctgg
ggccagggcgccgtgcgcctcgatgccatcgccgagaagcagaacattccccgaaagttc
ctgaccgttatcctttcggaaatggcgcgcgaaggcatcgtcatttcccatcgcggtcgc
gacggggggtatgaactcgcgcttccgcccgtcgacatccgctatggcgatatcattcgc
ctcacgcgcggcagtctcgcgctcgtgccttgcgccagccgcaatgcgcacgaacactgc
aacaactgcctaccggaggtcgactgccgcctgcgcggcctgatgctccagttgcgcgac
gagacagccgcgatcctcgatcgcataaccctggcggatccgattgcggtagagccgccc
ttcgcagaagcctga

DBGET integrated database retrieval system