KEGG   Novosphingobium aromaticivorans: Saro_1736Help
Entry
Saro_1736         CDS       T00322                                 

Definition
(GenBank) DNA replication and repair protein RecN
  KO
K03631  
DNA repair protein RecN (Recombination protein N)
Organism
nar  Novosphingobium aromaticivorans
Brite
DNA repair and recombination proteins [BR:nar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Saro_1736
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Saro_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1830078..1831742
Genome map
AA seq 554 aa AA seqDB search
MLTSLSIRNVVLIEALDLSFGGGLGVLTGETGAGKSILLDALGLVLGDRADSGLVRAGED
QASVTATFEFDRLPDAIRQALAEAEIDVEPGEPLIVKRRLKADGGSRAFINDQPVGVALL
RELARSLVELHGQHDDRGLVNARGHRALLDRYAGADVAGVEAAWGKWRKAEEALAAARAQ
VARAAEEQDLLLAHLAELTALAPVIGEEEELAGQRADMQKGERLSGDLAELQRLWEGSDS
ALAILRSAARRLDRIASEHPMLAEALEALDRAVIEAGEAEDKLASAAEALAHDPALLDRI
ETRLFDLRAVARKHACAVDDLPHRMHEMRLALDAIEGGEAQIADLERAAREAALDYQAKA
ETLSVQRAEAARRLDKAVAAELAPLRLDAARFHTAVLRLPEDRWGAGGMDAVEFLISTNP
GADFAPLGKIASGGELSRFILALKVALAEEGGAATIIFDEIDRGVGGAVASAIGERLARL
ASGGQLLAVTHSPQVAARGDRHYMIAKSSEGTVTRTSVSLLDAAARKEEIARMLSGAEVT
AEARAQADRLLEQA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccagcctgtcgatccgcaatgtcgtgctcatcgaagcgctcgacctgtcgttc
ggcggtgggctcggcgtgctcaccggcgaaaccggcgccggcaagtcgatcctgctcgac
gctctcggcctcgttctgggcgaccgcgccgatagcggcctcgttcgtgccggagaggac
caggccagcgtcaccgccactttcgagttcgaccgcctgcccgatgccatccgccaggcc
ctggccgaggcagagatcgacgtcgaaccgggcgaacctctgatcgtcaagcgccgcctc
aaggccgatggcggctcccgcgccttcatcaacgaccagcccgttggcgtcgccctcctg
cgcgaactggcccgcagcctggtcgaactccacggccagcacgacgatcgcggcctcgtc
aacgcgcgcggccaccgggccctgctcgatcgctatgccggggcggatgtcgccggtgtc
gaggcggcgtggggcaagtggcgcaaggccgaggaagcgctggccgccgcccgcgcccag
gtcgcccgcgcggccgaggaacaggatctactcctcgcccatctcgccgaactcaccgcg
cttgctccggtcatcggcgaggaagaggaactggccggccagcgcgccgacatgcagaag
ggcgaacgcctctcgggcgatctcgccgaactccagcgcctgtgggaagggtccgactcc
gcgctggccatcctgcgcagcgccgcgcgccggctcgatcgcatcgcatcggaacacccg
atgctggcagaagccctcgaagcgctcgaccgcgcggtgatcgaggcgggcgaggccgag
gacaagctcgccagcgcggccgaggcactggcccacgatccggcgctgctcgaccgtatc
gaaacccgcctgttcgacctgcgcgccgtcgcccgcaaacacgcctgcgcggttgatgat
ctgccccaccggatgcacgagatgcgcctggcgctcgatgccatcgaaggcggcgaggcg
cagatcgcggacctcgaacgcgccgcccgcgaagccgcgctcgattaccaggccaaggcc
gagacgctctcggtccagcgtgccgaagccgcgcgccgcctcgacaaggccgtggccgcc
gaactggccccgctcaggctcgacgcggcgaggttccacaccgccgtcctgcgtctgccg
gaagaccgctggggcgcgggcggcatggacgcggtcgaattcctgatatcgaccaacccc
ggcgccgatttcgcgccgctcggcaagatcgcgtcgggcggcgagctttcgcgcttcatc
ctcgcgctcaaggtcgcgctggccgaagaaggcggggccgcgacgatcatcttcgacgag
atcgaccggggcgtcgggggcgcggtcgccagcgccatcggcgaacgccttgcgcggctc
gcctccggtggccagcttctcgccgtcacccacagtccccaggtcgccgcgcgcggtgac
cggcactacatgatcgccaagtcctccgaaggcaccgtgacccgcacgtcggtcagcctg
ctcgatgcggcggcgcgcaaggaagaaatcgcccgcatgctctccggtgccgaagttacc
gccgaagcccgcgcccaggcagaccgcctgctcgaacaggcctga

DBGET integrated database retrieval system