KEGG   Novosphingobium aromaticivorans: Saro_1740Help
Entry
Saro_1740         CDS       T00322                                 

Definition
(GenBank) competence/damage-inducible protein cinA
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1835243..1835746
Genome map
AA seq 167 aa AA seqDB search
MLEILAAIAAQSGSALKARRQTIAVVDGSTGGLISASLLAMPGASAFYLGGGVVYTLKGR
RMVLGHEPGSLRGFTSATEPYALAQARLIRQRYGADWGIAETGASGGSAHPLGVASGTSA
IGVAGPEGIEATVQVVTQSDDRLANMLQFTRAALELLRDTLATHSTT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaattcttgccgccatcgccgcacagtccggatccgcgctcaaggcacggcgc
cagaccatcgccgtggtcgatggctcgaccggtggcctgatctcggccagcctgctcgcc
atgcccggtgcttcggcgttctatctgggcggcggggtagtctacacgctcaaggggcgg
cgcatggtgctgggccacgaacccggctcgctgcgcggcttcacttcggcgaccgagcct
tacgcgctggcgcaggcgcgcctgatccgccagcgctatggcgcggactggggcattgcc
gaaaccggcgcttcggggggcagcgcccacccgctcggtgtcgcctcgggcaccagcgcg
ataggcgtcgcagggcctgaagggatcgaggcgacggtgcaggttgtcacacagagcgat
gaccgccttgccaacatgctgcaattcaccagggccgcgctggaactcctgcgcgatacg
ctggccactcactccaccacgtag

DBGET integrated database retrieval system