KEGG   Novosphingobium aromaticivorans: Saro_1744Help
Entry
Saro_1744         CDS       T00322                                 

Definition
(GenBank) succinate dehydrogenase subunit C
  KO
K00241  
succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
nar  Novosphingobium aromaticivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1744
   00650 Butanoate metabolism
    Saro_1744
  Energy metabolism
   00190 Oxidative phosphorylation
    Saro_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1838728..1839153
Genome map
AA seq 141 aa AA seqDB search
MAQARKARPISPHLQIWRWGPAMLVSILHRITGNGLAFAGLGLLLWWVGALASGPESYQT
FLDWVWVGSAGGIQAVTAILGKIVLVGLSWAFFQHAASGIRHLILDIGAGYELDANARWS
SLTIVISVLLTIAFWAFVLLR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcgcgcaaagcacggccgatttcgccgcatctccagatctggcgctggggc
ccggccatgctggtctcgatcctgcaccgcatcaccggcaatggcctcgccttcgcgggc
cttgggcttctgctgtggtgggtcggtgcgctggcaagcggtccggaaagctaccagacc
ttcctcgactgggtctgggtcggcagtgccggcggcatccaggccgttaccgcgatcctc
ggcaagatcgtcctcgtcggccttagctgggccttcttccagcacgccgcctcgggcatc
cgccacctgatcctcgacatcggcgccggctacgaactggatgccaatgcgcgctggtcg
agcctgacgatcgtcatctcggtccttctcaccatcgcattctgggctttcgtgctgctg
cgctga

DBGET integrated database retrieval system