KEGG   Novosphingobium aromaticivorans: Saro_1745Help
Entry
Saro_1745         CDS       T00322                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nar  Novosphingobium aromaticivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:nar01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nar00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nar00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:nar00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839192..1839575
Genome map
AA seq 127 aa AA seqDB search
MGNGTSIGRVRGLGSSHEGTHHWLTARLTAVGNLVLITFLVVSLALLPDYSYATVRGWVA
RPVPSIALILIMINTFTHARMGVQVMLEDYVHEEGGKIAAWLLVNIVPFVAAAFGILSVL
RIALGGA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacggcacctccatcggtcgcgttcgcgggctgggttccagccacgagggcacg
catcactggctcaccgcgcgcctcacggccgtcggcaatcttgttctgatcacgttcctg
gtcgtcagcctcgcgctgctgccggactacagctatgccacggtgcgtggctgggtcgcg
cggccggtgccgtcgatcgcgctgatcctgatcatgatcaacaccttcacgcacgctcgc
atgggcgtgcaggtcatgctcgaggactacgtccacgaagagggtggcaagatcgcggcc
tggctgctggtcaacatcgtgcccttcgtggcagccgccttcggcatcctttcggttctg
cgcattgcgctcgggggcgcataa

DBGET integrated database retrieval system