KEGG   Novosphingobium aromaticivorans: Saro_1746Help
Entry
Saro_1746         CDS       T00322                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1746
   00650 Butanoate metabolism
    Saro_1746
  Energy metabolism
   00190 Oxidative phosphorylation
    Saro_1746
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Saro_1746
    1.3.5.4  fumarate reductase (quinol)
     Saro_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1839579..1841393
Genome map
AA seq 604 aa AA seqDB search
MTSTQPAYKIIDHTYDTVVVGAGGSGLRATMGSAQAGLRTACITKVFPTRSHTVAAQGGI
AASLGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNPEGT
IYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLIME
NGECRGVIALCMDDGSIHRFRSHAVVLATGGYGRSYFTATSAHTCTGDGGGMVLRAGLPL
QDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSM
AMEIREGRGVGPHKDHIYLHLDHIDQKVLAERLPGITESGKIFAGVDLTRQPLPVVPTVH
YNMGGIPTNYHGEVVTIGADGNPETIVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGR
ATGLRLKELIKPGTAHNSLPKDSADLALTRLDHFRHAKGGSPTAEVRIEMQRTMSAHAAV
FRTDELMAEGKVKLADTYKRMEDIHVSDRSLIWNSDLVETLELDNLISQATVTMHSAHNR
KESRGAHAHEDFPDRNDAEWMKHTATWFNGWGGKGGEVRIDYRPVHEYTLTDDVEYIKPK
KRVY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgactcagcctgcctacaagatcatcgaccacacctacgacaccgtcgtcgtg
ggcgcgggcggttcgggcctgcgcgcgaccatgggttcggcccaggccggcctgcgcacc
gcctgcatcaccaaggtcttcccgacccgttcgcacaccgtggcggcacagggtggcatc
gccgccagcctcggcaacaattcgccggaccactggacctggcacatgtacgacaccgtc
aaggggtctgactggctgggcgaccaggatgccatcgaatacatggtgcgcgaggctccg
gccgcggtctacgaactggaacacgcgggtgtcccgttcagccgcaaccccgaaggcacg
atctaccagcgtccgttcggcggtcacatgcagaacatgggtgaaggcccgccggttcag
cgcacctgcgccgccgccgaccgtaccggccacgccatgcttcacgcgctgtaccagcag
agcctgaagtacgacgccgacttcttcatcgaatacttcgcgatcgacctgatcatggag
aacggtgaatgccgcggcgtgatcgcgctgtgcatggacgacggctcgatccaccgcttc
cgcagccatgcggtcgtgctggcgaccggcggctatggccgttcgtacttcaccgcgacg
tcggcccatacctgcaccggcgacggcggcggcatggtgctgcgcgcgggcctgccgctg
caggacatggaattcgtgcagttccacccgaccggcatctacggcgcgggcgtgctcatc
accgaaggcgcgcgtggtgagggcggctacctgacgaactccgagggcgagcgtttcatg
gagcgctatgccccgtcggccaaggaccttgcgtcgcgcgacgtcgtgtcgcgttcgatg
gcgatggaaatccgcgagggtcgcggcgtcggtccgcacaaggaccacatctacctgcac
ctcgaccacatcgaccagaaggtgctggcagagcgtctgcccggcatcaccgaaagcggc
aagatcttcgcgggtgtcgatcttacccgccagccgctgccggtcgtgccgaccgtgcac
tacaacatgggcggcatcccgacgaactatcacggcgaagtcgtcaccatcggcgccgac
ggcaaccccgagacgatcgtcccgggtctgttcgcggtaggcgaagcggcctgcgtttcg
gtccacggcgcgaaccgccttggctcgaactcgctgatcgaccttgtcgtgttcggccgt
gccacgggcctgcgcctcaaggaactgatcaagccgggcaccgcgcacaactcgctgccc
aaggacagcgccgacctcgcgctgacccgcctcgatcacttccgccatgccaagggcggt
tcgcccaccgccgaagtgcgcatcgaaatgcagcgcacgatgtcggcccacgcggcggtg
ttccgcaccgacgaactgatggcggaaggcaaggtcaagctggccgatacctacaagcgc
atggaagacatccacgtgtccgaccgttcgctgatctggaactcggaccttgtcgaaacg
ctcgaactggacaacctgatcagccaggcgaccgtgacgatgcattccgcgcataaccgc
aaggaaagccgcggtgcccacgcgcacgaggatttccccgatcgcaacgacgccgagtgg
atgaagcacaccgccacctggttcaacggatggggcggcaagggtggcgaagtccgcatc
gactatcgcccggtccacgaatacacgctgaccgacgacgtcgagtacatcaagccgaag
aagcgcgtgtactga

DBGET integrated database retrieval system