KEGG   Novosphingobium aromaticivorans: Saro_1750Help
Entry
Saro_1750         CDS       T00322                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Saro_1750
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Saro_1750
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Saro_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1844153..1844938
Genome map
AA seq 261 aa AA seqDB search
MFLKDKCALVTGSTSGIGLAYARALAAEGAHIVLNGFGDPAEIEALCRELADASGGRAIF
AAGDLTRREGTEAMMATALAEFGAVDILINNAGMQHVAPVEEFPVEKWDAIIALNLTSAF
DACRLAIPGMKAKGWGRIIFTASAHSLTASPFKAAYVSAKHGIAGLTKTLALELATHGVT
ANCISPGYVWTPLVENQIPDTMKARGMTREQVINDVLLTRQPTKQFVQPEDVAALALFLC
RHEARNITGANYNMDGGWVAE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggacaagtgtgcgcttgtgactggctcgacctcgggcatcggccttgcc
tatgcgcgggctctcgcggcggaaggggcgcatatcgttctcaacggcttcggcgatccg
gccgagatcgaggcgctttgccgggaactcgccgacgccagcggcggacgagcgatcttt
gcggcgggggatcttacgcggcgcgagggcaccgaggcgatgatggcgacggcgctggcc
gaattcggcgcggtggacatcctgatcaacaacgccggcatgcagcacgtggcgccggtc
gaggagttcccggtcgagaagtgggatgcgatcatcgcgctcaacctcacgtcggccttc
gatgcctgccggctcgcaattccggggatgaaggccaagggctgggggcgcatcatcttc
acggcttctgcccactcgctcacggcatcgccgttcaaggcggcctatgtctcggcaaag
cacgggatcgcagggctgacgaagacgctggcgctggaactggcgacgcatggggtgacc
gccaactgcatcagccccggctatgtctggactccgctggtcgagaaccagatccccgac
acgatgaaggcgcgggggatgacgcgcgagcaggtgatcaacgacgtgctgctgacccgc
cagccgaccaagcagttcgtccagcccgaggacgtggccgcgctggcgctgttcctgtgc
cggcacgaggcgcgcaacatcaccggtgcgaactacaacatggatggtggctgggtggcg
gaataa

DBGET integrated database retrieval system