KEGG   Novosphingobium aromaticivorans: Saro_1757Help
Entry
Saro_1757         CDS       T00322                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase-like protein
  KO
K00174  
2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1757
   00020 Citrate cycle (TCA cycle)
    Saro_1757
   00620 Pyruvate metabolism
    Saro_1757
   00650 Butanoate metabolism
    Saro_1757
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     Saro_1757
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     Saro_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1851520..1853424
Genome map
AA seq 634 aa AA seqDB search
MCAAEDDMATLVDGPDALTGGKDNPTPEAVVVRFAGDSGDGMQLTGGQFTLSTALAGNDL
ATFPDFPAEIRAPQGTLFGVSAFQINFGSTDIDTAGDQPDVLVAMNPAALKTNVGALKAG
GLIIADTGEFNKRNLEKAKYEVNPLEDGSLANWQLLAFDISAMTLEAVKPFGLGNKEALR
CKNMWTLGLALWMFDRDRQPLIDWLNAKFKKSPVLAEANIAALNAGHAYGETAELAGPLK
QYHIAPVESEPGLYRTVTGAEAVSLGLVAGAQLAELPMFFGGYPITPASAILHNLARLKE
FGVTTFQAEDEIAAIASAIGASYAGQLGVTSSSGPGIALKGEAMGLAIMTELPLVIVNSQ
RGGPSTGLPTKTEQSDLYQAVYGRNGDAPMPVIAARSPADAFDCAIEACRLAVQYMTPVM
LLTDGYIGNAAEPWKVPDPASYTPFPARFLTERNGPNGELLPFARDEKGARPWIKPGTPG
LMHRIGGIEKNPGTGNIDYSPASHQLMTDARKAKVDGIAAGIPEQDVTLGEASGKLAVVG
WGSTYGPIHQAVRRARRKGMDVSHIHVRHVWPLPTNLGELLASYDKVLVPEMNTGQFKTV
LRDQYLIDAKPLNKTSGQPFTIAEIEAAIEAALA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcagcagaggacgatatggctacactagttgatggaccggacgcgctgacgggc
ggcaaggacaacccgacgcctgaggcagtggttgtgcgcttcgccggtgactcgggcgat
ggcatgcagctgaccggcggtcagttcacactttccaccgcgctggccggaaacgacctc
gcgaccttcccggactttccggcggagatccgcgcgccgcaggggacgctgttcggcgtt
tccgcattccagatcaacttcggctcgaccgacatcgacaccgcgggcgaccagcccgac
gtgctggtggcgatgaaccccgccgcgctcaagacaaacgtcggcgcgctcaaggccggt
ggcctgatcatcgccgacaccggcgagttcaacaagcgcaacctcgagaaggccaagtac
gaggtcaacccgctcgaggacggcagcctggccaactggcaactgctggcgttcgacatc
tcggcgatgacgctcgaggcggtgaagccgttcggccttggcaacaaggaagcgctgcgc
tgcaagaacatgtggacgctcggccttgcgctgtggatgttcgaccgtgaccgccagccg
ctgatcgactggctgaacgccaagttcaagaagagcccggtgctggcggaagccaacatc
gccgcgctcaacgccggccacgcctatggcgagacggcggaactggccgggccgctcaag
cagtaccacatcgcaccggtcgaaagcgaaccgggcctctaccgcaccgtcaccggcgcg
gaagcggtcagcctcggtcttgttgccggtgcgcagcttgccgaactgccgatgttcttc
ggcggctatccgatcaccccggcttccgcgatcctgcacaacctcgcgcggctcaaggaa
ttcggcgtcaccaccttccaggcggaagacgagatcgccgcgatcgcttcggccatcggc
gcgagctacgccggtcagcttggcgtgacgtcatcgtcggggccgggcatcgcgctcaag
ggcgaggcgatgggccttgccatcatgaccgaactgccgctggtcatcgtcaactcgcag
cgcggcggtccctcgacgggcctgccgaccaagaccgagcagtccgacctctaccaggcg
gtctacggccgcaacggcgacgcgccgatgcccgtgatcgcggcgcgttcgccggccgat
gccttcgactgcgccatcgaggcctgccgccttgccgtgcagtacatgaccccggtcatg
ctgctgaccgacggctacatcggcaacgccgccgagccgtggaaggtgccggatcccgcc
agctacacgccgttccccgcacggttcctgaccgagcgcaatggccccaacggcgagctt
ctgcccttcgcccgcgacgaaaagggcgcccgtccgtggatcaagccgggcacgcctggc
ctgatgcaccgcattggcggcatcgagaagaacccgggcaccggcaacatcgactacagc
cctgccagccaccagctcatgaccgatgcccgcaaggccaaggtcgacgggattgccgcc
ggcattccggagcaggacgtcacgctgggcgaggcttcgggcaagctcgcggtcgttggc
tggggcagcacctatggcccgatccatcaggccgtccgccgcgcccgtcgcaagggtatg
gacgtgtcgcacattcacgtgcgccatgtctggccgctgccgaccaaccttggcgaactg
ctggccagctatgacaaggtgctcgtgccggaaatgaacacggggcagttcaagaccgtc
ctgcgcgaccagtacctgatcgacgccaagccgctcaacaagaccagcggccagcccttc
accatcgcggaaatcgaagccgcgatcgaagctgcgctcgcataa

DBGET integrated database retrieval system