KEGG   Novosphingobium aromaticivorans: Saro_1758Help
Entry
Saro_1758         CDS       T00322                                 

Definition
(GenBank) thiamine pyrophosphate enzyme-like TPP-binding protein
  KO
K00175  
2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saro_1758
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1758
   00020 Citrate cycle (TCA cycle)
    Saro_1758
   00620 Pyruvate metabolism
    Saro_1758
   00650 Butanoate metabolism
    Saro_1758
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     Saro_1758
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     Saro_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1853436..1854476
Genome map
AA seq 346 aa AA seqDB search
MNEMTKIAVQTTLKDWETDQEVRWCPGCGDYAILKAVQRTLPDLGADPANTVFVSGIGCS
SRFPYYVESYGFHTIHGRAPAFATGIKLANPDLDVWLVTGDGDGMSIGGNHTMHVLRRNV
NLQILLFNNEIYGLTKGQYSPTSREGTPSPTSPLGSVDRPASPCAFALGSGARFIARAYD
VSKDLPSVLKAAHAHKGAAFVEIFQNCIVYNKDRFDDFTAKGVADANQLWVKDGEPMLFA
KGTKGIALDIESLTLKVVDVVDGDWKAAGVIVHNVHNRAVAHMLVEMPFGPFPMALGVIY
DDPRPTYEETLLGQDAQARAGKEANLAKLLGKGQTWTVGNTAADPV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgaccaagatcgcggtccagaccacgctgaaggactgggaaaccgaccag
gaagtgcgctggtgcccgggttgcggcgactacgcgatcctcaaggccgtgcagcgcacg
ctgcccgacctgggcgcagatccggcaaacacggtgttcgtttcgggcatcggctgctcg
agccgcttcccgtactacgtggaaagctatggcttccacacgatccacggccgcgcccct
gcgttcgccaccggtatcaagctggcgaacccggacctcgatgtctggctggtgacgggc
gacggcgatggcatgtccatcggcggcaaccacacgatgcacgtcctgcgtcgcaacgtg
aacctgcagatcctgctgttcaacaacgagatctacggtctcaccaagggccagtactcg
cccacgagccgcgagggcacgccaagcccgacttcgccgctgggttcggtcgatcgtccg
gccagcccctgcgccttcgcgctgggttcgggcgcgcggttcatcgcgcgggcctatgac
gtgtcgaaggacctgccttcggtgctcaaggccgcccacgcgcacaagggcgcggcgttc
gtggaaatcttccagaactgcatcgtctacaacaaggatcgcttcgacgacttcaccgcc
aagggcgtggccgacgcgaaccagctctgggtcaaggacggcgagccgatgctcttcgcc
aagggcaccaagggcattgcgctcgacatcgagagcctgacgctgaaggtcgtcgatgtg
gtcgatggcgactggaaggccgcgggggtgatcgtccacaacgtccacaatcgcgcggtc
gcgcacatgctggtcgagatgccgttcggcccattcccgatggcgctgggcgtgatctac
gacgatccgcgtccgacctacgaggaaacgctcctcggccaggacgcacaggcgcgcgcc
ggcaaggaagcgaacctcgccaagctgctgggcaagggacagacctggaccgtaggcaac
acggccgccgacccggtctga

DBGET integrated database retrieval system