KEGG   Novosphingobium aromaticivorans: Saro_1759Help
Entry
Saro_1759         CDS       T00322                                 

Definition
(GenBank) deoxyribodipyrimidine photo-lyase type I
  KO
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     Saro_1759
DNA repair and recombination proteins [BR:nar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    Saro_1759
 Prokaryotic Type
    Saro_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1854600..1855964
Genome map
AA seq 454 aa AA seqDB search
MSDPVIVWFRRDLRLADQAALLAAAAEGPVIPVYILDDDTPRHCRMGGASRWWLHHSLAE
LDASLRKLGSRLILRRGKCHEELAAVRREAGARVVHALQHYEPWWRNAEKAVAKTIRLVL
HEGNYLAPAGSVRTGMGRPYKIYTPFWHALLERMPPAPPLPAPERLEAPAVWPTSDALDD
WKLLPTAPDWAGGFRETWTPGENGAEERLQDFADRVARYGETRNLPSIEGTSRLSPHLHF
GEISPATIWHRVVNAGGSVDVFLGELGWRDYAQNVIVQFPDYGSRNAREAYDRLEWRDDP
EALRAWQQGRTGYPIVDAGMRELWHTGWMHNRVRMIAASFLVKHLLIDWREGERWFWDTL
VDADYASNAVNWQWTAGTGVDSNMFVRIMAPLTQSPKFDAAGYIRQWVPELAHLSDRDIH
DPAVPPRGYPAKIVSHSEARARALAAHDRMKQPA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccccgtaatcgtctggttccgacgcgacctccgccttgcagatcaagccgcc
ctcctggctgccgcagccgaggggccggtcattcccgtctacatcctcgacgacgatacc
ccgcgccactgccgcatgggtggagcgtcgcgctggtggctccaccacagcttggccgag
cttgatgcctcgctgcgcaagcttggatcgcgcctgatcctgcgtcggggcaagtgccac
gaggagcttgccgccgttcgccgcgaggccggggcgagggtcgttcacgcattgcagcac
tacgagccttggtggcgcaatgccgaaaaggcggtggccaagacaatccgcctggtcctt
cacgaaggcaactatctggcccccgccggttccgtccgcaccgggatgggccggccctac
aagatctacacgcccttctggcatgccctgctcgagcgcatgccccctgcgccgcccttg
ccggcacccgaacggctcgaagcgcccgccgtctggcccacgagcgatgcgctggacgac
tggaagctgcttccgacggcacccgactgggcaggtgggttccgcgagacatggactccg
ggcgagaacggtgcggaagagcggcttcaggactttgccgaccgtgtggcccgctacgga
gaaacgcggaacctgccttcgatcgaaggcacctcgcgcctttcgccccaccttcatttc
ggcgagatctctccagccacgatctggcatcgggtggtgaatgcgggcggttcggtcgac
gtgtttctgggtgaactgggttggcgcgactatgcccagaacgtaatcgtgcaattcccg
gactacggttcgaggaatgcgcgcgaggcgtacgaccggctcgaatggcgcgacgatccc
gaggcattgcgcgcctggcaacagggccggaccggctatcccatcgtcgatgccggcatg
cgcgagctctggcacaccgggtggatgcacaaccgggtgcggatgatcgccgccagcttc
cttgtgaaacaccttctgatcgactggcgcgagggcgagcggtggttctgggacacgctg
gtcgatgccgactatgcatccaacgcggtcaactggcagtggacagccggtacgggcgtc
gattccaacatgttcgtcaggatcatggcgccgctgacccagtcaccgaagttcgacgcg
gcaggctatatccggcaatgggtgcccgaactggctcatctttccgaccgcgatattcac
gatcccgccgttccgccgcgcggctatccggcaaagatcgtcagccattccgaggcgcgg
gcacgtgcccttgccgcgcatgacaggatgaagcagccggcgtga

DBGET integrated database retrieval system