KEGG   Novosphingobium aromaticivorans: Saro_1761Help
Entry
Saro_1761         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1857280..1857633)
Genome map
AA seq 117 aa AA seqDB search
MNTTDWNTSVYGQAALEDRCAPRQRVNIPASLRPSGGRGFQTVVLDLSLGGFCANALQKM
YPGNRCWLTIPGMEALQAEVVWWDAGRVGCAFANLLSPIVHDNILARYRGDGVFRRV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccgattggaatacgagtgtctatgggcaagccgcgctggaagaccggtgc
gcgcccaggcaacgcgtcaacattccggcatcgctgcgaccatccggcgggcgcggcttc
cagaccgtcgtactggatctgtcgcttggcggattctgcgccaacgcgctgcagaagatg
taccccggcaatcgctgctggctgacgatccccggcatggaagcgcttcaggccgaagtg
gtgtggtgggatgcgggccgcgtcggatgcgccttcgcgaacctgctaagccccatcgtc
cacgacaacatcctcgcccgctatcgtggcgacggcgtgttccggcgggtgtaa

DBGET integrated database retrieval system