KEGG   Novosphingobium aromaticivorans: Saro_1762Help
Entry
Saro_1762         CDS       T00322                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1857722..1858453)
Genome map
AA seq 243 aa AA seqDB search
MSAQGSQDGRFAGQLALVTGASRGIGAATAKALAAQGAHVVLVARTAKELEKVEEEIFEA
GGSATIAPVDLSEPEGIARLATAISGRWSALDVLVINAAAFPTLTPVWQIDSREFNNALT
LNVLATQALLAGFDGMLKKSKDARVIGVTSSVGATPRAYWGAYGASKAAFDVLLDCYAQE
VRNTSAVRVAILDPGATRTKMRARAYPGENPESVKAPEVVAERMVALLGEQFSSPHRERV
NQD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagggttcgcaggacggccgctttgccggccagttggcgctcgtcaccggc
gcgagccggggcatcggtgccgccacggcaaaggcgcttgccgcacagggcgcgcatgtc
gtactcgtggcccggaccgccaaggagcttgaaaaggtcgaggaagagatcttcgaggct
ggcggcagcgcgacgatcgctccggtcgacctgtccgagcccgaaggcatcgcccgcctt
gccaccgcgatctcgggccgctggagcgcgctcgacgtactcgtcataaacgccgccgcc
ttccccacgctgacaccggtctggcagatcgactcgcgcgagttcaacaatgcgctgacg
ctgaacgtcctcgccacgcaggcgctgctcgccggtttcgacggcatgctgaagaagagc
aaggacgcccgcgtcatcggcgtgaccagcagcgtcggcgcgacgccgcgcgcctactgg
ggcgcctatggcgcgtcgaaggccgcgttcgacgtcctgctcgactgctacgcgcaggaa
gtgcgcaacacctcggccgtgcgcgtcgcaattctcgatccgggcgccacgcgcaccaag
atgcgcgcaagggcctatcccggcgaaaacccggaaagcgtgaaggcgcccgaagtcgtt
gccgaacgaatggttgcgcttcttggtgaacaattttccagtccgcaccgcgaacgcgtt
aaccaggactga

DBGET integrated database retrieval system