KEGG   Novosphingobium aromaticivorans: Saro_1764Help
Entry
Saro_1764         CDS       T00322                                 

Definition
(GenBank) putative integral membrane sensor protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1860227..1861168
Genome map
AA seq 313 aa AA seqDB search
MRLNRLLAGPVGVAVTFFVLASTTVHFARFSGGVAMVWVAGAMLAGRLIVLPERQWMPWL
LWSGVASVMVTGLYGLGWLAAVPFAVVNVAEAAAAALIWRRITEAFWPDETVEWLAAFYI
GIGLSIPLASGGVATLVAWAFVGLPPVENFLHWIVGHALGLIACLPVFTFIYRRAERGRS
ILPSAEALPVSLLVLFCFALLTGLVFVLDMRALLVFPLLFFVVGTAVLDEETVVFFPILL
ILIGGTLTGLDMGPIAQMDVDYGDRIQFFQLYVGVAVLAALPISCERTRRLQELRVMRER
LALFEGSGNRHPD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcaatcgccttcttgctggaccggtcggtgtggccgtgacgttcttcgtcctg
gcgagcacgaccgtgcattttgcgcggttctcgggcggcgtggcgatggtctgggtggcc
ggggccatgcttgcgggccggctcatcgtccttccggagcggcagtggatgccctggctt
ctctggtccggggtggcgagcgtgatggtgaccgggctgtatgggctgggctggctggcc
gcagttccctttgccgtggtgaacgtggccgaggccgccgccgcggcgctcatctggcga
cggataacggaagcgttctggcctgacgagacggtcgaatggctcgccgccttctacatc
ggtatcggcctgagcattccgctggcgtcgggcggtgtcgccacactcgtggcatgggcc
tttgtcggcctgccgcctgtcgagaactttcttcactggatcgtggggcatgcgctcggc
ctgattgcctgcctgccggtctttacgttcatctaccgtcgcgccgaacgcgggcgcagc
atcctgccgagtgccgaagccttgcctgtaagcctgctggtgctattctgcttcgccttg
ctcacgggcctggtgttcgtgctcgacatgcgtgcgcttctcgtctttccgctgctcttc
ttcgtcgttggcacggccgttctcgatgaagagaccgtcgttttctttccgatcctgctt
attctcatcggcggtacgctgaccgggctcgacatggggccgatcgcgcagatggacgtg
gattacggcgaccgcatccagttcttccagctctacgtcggcgttgccgtcctcgccgcc
ttgccgatctcgtgcgagcgaacgcgccgccttcaggaactcagggtcatgcgagagcgt
ttggcgctgttcgagggctcggggaaccgtcacccggattga

DBGET integrated database retrieval system