KEGG   Novosphingobium aromaticivorans: Saro_1765Help
Entry
Saro_1765         CDS       T00322                                 

Definition
(GenBank) Lipoprotein releasing system, transmembrane protein, LolC/E family
  KO
K09808  
lipoprotein-releasing system permease protein
Organism
nar  Novosphingobium aromaticivorans
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:nar00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Saro_1765
Transporters [BR:nar02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Saro_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1861258..1862499
Genome map
AA seq 413 aa AA seqDB search
MILSPFEWTIAKRYMLPGRGEAFIALVAGISLVAVMLGVAALVIVMSVMNGFRAELLDKI
VGLNGHAIIQAYGGRLDNWQDILKRVQQTPDVTHASPLIEQPLLASFNGRVEAILVRGNT
AEDIKRLEDKRVDGVIGSLRPGSGNVALGSRLAENLGARVGDSITIINPQGRSTPFGTVP
REIAYTVSAIFEVGVYDYDQAYVVMPISDAQTLLLTGDTIGMIEVTTTNADTVMDTLGPL
KKELEGQAVVTDWKTINASLFEALAVERVAMFIVLSIIVLVAVFNILSSLIMLVRAKTRD
IAILRTMGATRKSLLKIFVTIGFVIGALGTLSGLALGFVFLFFRQPIVNAIQYLTGQNLW
DPSIRFLTELPSRSDPVEITTICLMALLFSFLATLYPALKAASTDPVQVLRYE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctgtctccgttcgaatggaccatcgccaagcgctacatgctgccggggcgaggg
gaggctttcatcgcactcgtcgccggtatcagcctcgtggcggtcatgctgggcgttgcc
gcgctcgtcatcgtgatgagcgtgatgaacggcttccgcgccgaactgctcgacaagatc
gtcggcctcaacggccacgcgatcatccaggcctatggcggccggctcgacaactggcag
gacatcctcaagcgcgtccagcagacgcccgacgtgacccacgcctcgccgctgatcgag
cagccgctgctcgccagcttcaacggccgagtcgaggcgatcctcgtgcgtggcaatacg
gcggaggacatcaagcggctcgaggacaagcgcgtcgacggtgtcatcggctcgctgcgc
cccggctcgggcaatgtcgccctagggtcgcgccttgccgaaaaccttggcgcgcgcgtg
ggcgacagcattaccatcatcaacccgcaaggcaggtcgaccccgttcggcactgtcccg
cgcgagatcgcctataccgtttcagcgatcttcgaggtcggcgtctacgactacgaccag
gcctatgtcgtcatgcccatctccgatgcgcagaccctgctgttgacgggcgacactatc
ggcatgatcgaggtgacgacgaccaacgccgacacggtgatggataccctggggccgctc
aagaaggagctggaaggccaggccgtcgtcacggactggaagaccatcaacgccagcctg
ttcgaggcgctcgcggtggaacgcgtggcgatgttcatcgtgctttcgatcatcgtgctg
gtagcggtgttcaacatcctgtcatcgctgatcatgctggtacgcgccaagacccgcgac
atcgcgattctgcgcacgatgggggcgacgcgaaagagcctgctcaagatcttcgtgacc
atcggtttcgtgatcggggcgctgggcaccctatcggggctcgcgctcggcttcgtgttc
ctgttcttccgccagcccatcgtcaacgcgatccagtatctcaccgggcagaacctgtgg
gacccctcgatccgtttcctcaccgaactgccgagccgctccgatcccgtggagatcacc
acgatctgcctgatggcgctgctgttcagcttccttgcgactctttatccggcgctcaag
gcggcgagcacggaccccgttcaggtgctgcgttatgagtga

DBGET integrated database retrieval system