KEGG   Novosphingobium aromaticivorans: Saro_1766Help
Entry
Saro_1766         CDS       T00322                                 

Definition
(GenBank) ABC transporter related protein
  KO
K09810  
lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
nar  Novosphingobium aromaticivorans
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:nar00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Saro_1766
Enzymes [BR:nar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Saro_1766
Transporters [BR:nar02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Saro_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1862492..1863166
Genome map
AA seq 224 aa AA seqDB search
MSDPVVRLRELRRSFSQGGVTIDVLRGVNLEIRPGEIVALLGPSGSGKSTMLQAIGLLEG
GFSGLIEIAGTDASKLSGDDRTALRRDHLGFVYQFHHLLPDFNAIENVVLPQLVAGTDRA
VAEARAAELLSALGLAKRLDHRPSQLSGGEQQRVAVARALANRPEMVLADEPTGNLDEAT
ADRVLEEFLKLVRGEGSAALIATHNERLALRMDRVVRLHEGVLE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatccagtggtgcgcctgcgcgagctgcgccgttccttcagccagggcggggtc
accatcgacgtcctgcgcggcgtcaacctcgagatccgccccggcgagatcgtcgcgctg
ctcggcccttcgggatcgggcaagtcgaccatgctccaggccatcggcctgctcgagggt
ggtttttccggcctgatcgagatcgccgggaccgatgcgtcgaagctttcgggcgacgac
cgcacggccctgcgccgcgatcacctcggcttcgtctaccagttccatcatctcctgccc
gatttcaacgcgatcgagaacgtcgtcctgccccagctcgttgccggcacggaccgcgcc
gtggccgaggcgcgcgcagcggaactcttgagcgccctcggcctcgccaagcgtctcgac
caccggccgagccagctttccggcggcgagcagcagcgcgttgcagtggcccgtgctctt
gccaatcgccccgaaatggttctcgccgacgagcccaccggcaatctcgacgaggcgacg
gccgaccgagtgctcgaggaattcctcaagctcgtgcgcggggaagggagcgctgcactg
atcgccacgcacaacgaacgccttgcgttgcgcatggaccgcgtcgtgcgtcttcacgaa
ggcgttctcgaatag

DBGET integrated database retrieval system