KEGG   Novosphingobium aromaticivorans: Saro_1773Help
Entry
Saro_1773         CDS       T00322                                 

Definition
(GenBank) Radical SAM
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1870043..1871179)
Genome map
AA seq 378 aa AA seqDB search
MDHLWTPRRKRLAILFSLCSFRAMAIHGRGAQLARVPDRFGLAAREADGDWMDEREGLDG
PGPKLRTTVTLEHPRSILTFNRSPDIPFDRSVNAYRGCEHGCIYCYARPTHAYHDLSPGL
DFETKLFAKPDAARLLRETLAKPGYAPAPIAMGTNTDPYQPIEGRYRITREILQLCLELR
HPVTITTKSARVIDDLDLLTELARHRLTAVGISVTSLDPRLSGLLEPRASSPAKRLDALE
KLVVAGVPAHVSVAPVIPSITDEFMEGILAAAAERGVRSASWIMVRLPHEVAPLFREWLD
THFPDRAGKVMSIVQAVRGGKDYDAKFFTRMKPEGIWADLIRTRFRVACRKYGIGKAEID
LDCTQFRKPSRNGQLDLF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggatcatttgtggacgccgcgccgcaagcgacttgcaattttgttctctttatgttcg
tttcgcgccatggccattcacggaagaggtgcgcaattggcgcgtgtcccggacaggttc
gggctggctgcgcgcgaagccgatggcgactggatggacgagcgcgagggactggacggc
ccgggacccaagctgcgcacgaccgtaacgctcgaacatccgcgctcgatcctcaccttc
aatcgttcaccagacattccgttcgatcgatcggtcaacgcctatcgcggctgcgaacat
ggctgcatctactgctacgcccggcccacgcacgcctatcacgacctttcgccggggctg
gatttcgaaacgaagctctttgccaaacccgatgcggcaaggcttctgcgcgagaccttg
gcaaagccggggtacgcccctgctcctatagcgatgggcacgaacaccgacccctatcag
cccatcgaaggccgctatcgcatcacccgcgagatcctccagctctgcctcgaactgcgt
cacccggtgacgatcaccacgaaatccgcgcgcgtcatcgacgatctcgatctgctgacc
gaactggcgcggcatcgactgaccgctgtcggcatctcggtcaccagcctcgatccgcgc
ctgtccggcctgctcgaaccccgcgcgagttcgccagccaagcgactggacgcgctggaa
aagcttgtcgtcgccggtgtccctgcccatgtctcggtcgctcctgtgatcccgtcgatc
accgacgaattcatggaaggcattctggcggcggcggcggaacggggcgtccgctcggca
agctggatcatggtccgcctgccccacgaagtcgcgccgcttttccgcgaatggctggac
acgcacttccccgaccgcgcgggcaaggtcatgtccatcgtccaggcagtgcgcggcgga
aaggattacgacgcgaagttcttcacccggatgaagcccgaaggcatctgggccgacctc
atccgcacccgcttccgcgtcgcctgccgcaagtacggcatcggcaaggcggagatcgac
cttgactgcacgcaattcagaaaaccgagccgcaacgggcagttggaccttttctag

DBGET integrated database retrieval system