KEGG   Novosphingobium aromaticivorans: Saro_1774Help
Entry
Saro_1774         CDS       T00322                                 

Definition
(GenBank) periplasmic sensor signal transduction histidine kinase
  KO
K07642  
two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Two-component system
Module
BaeS-BaeR (envelope stress response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:nar00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Saro_1774
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Saro_1774
Protein kinases [BR:nar01001]
 Histidine protein kinases
  OmpR family
   Saro_1774
Two-component system [BR:nar02022]
 OmpR family
  BaeS-BaeR [MD:M00450]
   Saro_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1871233..1872684
Genome map
AA seq 483 aa AA seqDB search
MRVRIGTIVFAGSALSALLGAVAMGLAMWIAQREGFSHYLATRDAERLDQLVRRFDEEAV
ARGGIAAFRAGRFTLGEAFGALGPPPITGHVSPEGDRSPPRGRPPPSEDIGGRLVLFDAS
GERLSGPERPPVLPGMDGRPPPPRIEHRTLTVEGVQVGTIAMLPRVPANGDVEARFLQSQ
VRYGLLALLVVVLLCLYPSWLVGRAGARAAGRFARRTAAIAAGDYYRYDRKPSFVVELDA
VGLDLSRMAGSLQRMESARRRWLAEIAHELRTPLAVLRGEIEALRDGIRQPGRAEIDSLL
AEAGSLGRLVDDLHFLSVSELEGMACHFEQVDPAEICGLALRRAQILSKAEGLSFALSVS
GNGVGTAWWDRDRIDQLLANLLANACRYTDRPGKIEMLLHAEHDGLRIVIDDTPPGVDPA
HLPHLFEPLYRADPSRSRASGGSGLGLSVCATIVEAHGGAIAAGSSPLGGLRVTVDLPRR
SAA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttcgaatcggaaccatcgtctttgcgggatcggccctgtctgcgctgctcggg
gcggtcgcgatggggctcgccatgtggattgcccagcgcgaaggcttttcgcactatctc
gcaacccgcgatgccgagcggctcgaccagctggttcggcggttcgacgaggaggctgtc
gcgcgaggcggaattgctgccttcagggcggggcgcttcacgcttggcgaggctttcggc
gcgctcgggcctccgccgataacgggccacgtgtcgcctgagggcgaccgctcaccgccc
agaggccgtccaccaccgtcggaagacatcggcgggcgcctggtgctgttcgatgcctcg
ggcgagcgcctttccggccctgagcgtccgcctgtgctgccaggcatggacggcaggcct
ccgccgccgcgcatcgagcaccgcacgcttacggtcgaaggcgtgcaggtcggcacgata
gcgatgctgccccgcgttccggcaaacggcgacgtcgaggccaggttcctgcaaagccag
gttcgctatggcctgttggccttgctcgtggtcgttctgttgtgcctctatccgtcatgg
ctggtagggcgagccggtgcccgcgctgccggccggttcgcacgccgcaccgcagccatc
gcggcgggcgactattatcgctacgaccgcaagcccagcttcgtcgtggaacttgacgcc
gtggggctggacttgtcgcgcatggcaggcagcctgcagcggatggaaagcgcgcgcagg
cgctggcttgccgagatcgcgcacgaattgcgaacgccactggcggtgctgcgcggggag
atcgaagccctgcgcgacggtatccggcagcccggacgcgccgagatcgattccctcctg
gccgaggccggatcgctcggcagactggtcgacgacctgcatttcctgtcggtttccgag
ctggagggcatggcttgccacttcgagcaggtcgatcctgccgaaatctgcgggctggcc
ctgcgccgggcacagatcctgtcgaaggccgaggggctgtcgttcgctctttccgttagc
ggcaatggcgttggcacggcttggtgggaccgcgaccggatcgaccagttgctcgccaac
ctgctcgccaacgcgtgccgctacaccgaccgcccaggcaagatcgagatgctgcttcac
gcggagcacgacgggctgcggatcgtcatcgacgacacgccgccaggcgttgatcccgcc
catttgccacacctgttcgagcccctctatcgcgcggacccttcgcgctcgagggcgagc
ggaggcagcggactggggctttcggtctgcgccacgatcgttgaggcgcatggcggagcg
attgccgccgggtcgtctccgttgggcgggcttcgcgtgacagtggaccttccgcgccgg
agcgccgcatga

DBGET integrated database retrieval system