KEGG   Novosphingobium aromaticivorans: Saro_1776Help
Entry
Saro_1776         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1873372..1874169)
Genome map
AA seq 265 aa AA seqDB search
MNRQPPGRTFGSKRLSKPIGSHCWEGGQQGTGRTGPWGKWRASFHLSQPGRPPRSFRTLR
GGAATFFFLRAAALLVAALFAIAATSPATAHALPPATATINLVGDRAYVAAAVPLEMVPR
VDTNRDGLIDAREAEVSGAAFEEALLSRLWLRTASGNASFVFAFTPGDTEPSPYVVVMAG
FQLRDSSGPLTVRTRLGSEALPVQFKVSRGKELENLTVSASDETHTFLTSGTYQTARDRK
VFVVIVVLAGTLTILAVLLLLSGRR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaggcaaccgcccggcagaacgttcgggtcgaaacgtctttccaagcccatcggg
tcgcactgctgggaggggggacaacaaggaaccggtcgcaccggtccatggggaaagtgg
cgggcatcgttccacctttcccaacctggccgcccgccgcgctcttttcgcaccctacgc
ggcggtgcggccactttctttttcctgcgcgcggcagcattgctggtggcggcattgttc
gcaatagcggccaccagtccggccaccgcccacgcactcccgccggcaacggcaaccatc
aatctcgtcggcgatcgtgcctatgtcgcggcggctgtcccgctggagatggtgccgcgt
gtcgacaccaatcgcgacgggctgatcgatgcgcgtgaagcagaggtcagcggcgctgcg
ttcgaagaagcgcttctgtcgcgcctctggctgcggactgcatcgggcaacgccagcttc
gtcttcgccttcacccccggcgacaccgaaccctcgccctacgtggtcgtcatggcgggc
ttccagcttcgggacagcagcggccccctcaccgtccggacccgcctcggatcggaagcg
ttgccggtgcagttcaaggtcagccgcgggaaggaactggagaacctgaccgtctccgcg
tcggacgaaacgcacaccttcctgacatccggaacctaccaaaccgcgcgggaccgcaag
gtgttcgtcgtcatcgtggtgcttgccggcaccttgactatcctcgccgttctccttctg
ctttcaggccgacgctga

DBGET integrated database retrieval system