KEGG   Novosphingobium aromaticivorans: Saro_1780Help
Entry
Saro_1780         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
  KO
K21929  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:nar00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Saro_1780
Enzymes [BR:nar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Saro_1780
DNA repair and recombination proteins [BR:nar03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Saro_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1877572..1878348)
Genome map
AA seq 258 aa AA seqDB search
MPDTADKPAPSFGDALAAALDWWRDAGVDGTFVDEPQDWLAAARLAAAAQAPTPQKPLRE
LIAERDDSPPPPTVSDRSGWPTELAAFADWWLAEPVLAPAGLRRLVPAGPAGAKLMIVVP
MPSADDGDTLLSGRAGRLLDAMLAAMGLERGETYIASAIPAHVPMPDWAALRQAGIGDVL
LHHIALVAPDRLLILGATSISTLLGNDPPNLAHSLQAINQNPSVIAALPAWDLEAMLARP
ALKAGFWSRWLDWTGTGT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgacaccgctgacaaaccagccccctctttcggcgatgcccttgcggcagcgctg
gattggtggcgcgacgccggggtggacgggaccttcgtcgacgagccgcaggattggctg
gccgccgcgcgccttgccgccgcggcccaggcccctactccgcagaagccgcttcgcgaa
ctcatcgccgaacgcgacgattcgccgccacccccgacggtaagcgaccggtccggctgg
ccgacggaactggccgccttcgcggactggtggctggcagagcccgtcctcgcgccggca
gggctgcgccgactggtgcctgccggtccggcgggggcaaagttgatgatcgtcgtgccg
atgccctcggcggacgatggcgacacgctcctctcgggccgagccggccggctgctcgac
gcgatgctggcggctatgggcctcgagaggggcgagacctacatcgcctctgccatacct
gcgcacgtgcccatgccggactgggcggccctgcgccaagccgggatcggcgacgttctg
ttgcaccacatcgctctggttgcccctgatagactgctgatactgggcgcaaccagcatt
tcgacgcttctgggcaacgatccaccgaatttggctcacagtttacaggcaattaatcaa
aacccctcagtaatcgccgcattgcccgcgtgggatcttgaggcaatgctggcacggccc
gcgctcaaggcgggcttctggagccgctggctcgactggacggggactggaacgtag

DBGET integrated database retrieval system