KEGG   Novosphingobium aromaticivorans: Saro_1783Help
Entry
Saro_1783         CDS       T00322                                 

Definition
(GenBank) N-formylglutamate amidohydrolase
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1880973..1881695
Genome map
AA seq 240 aa AA seqDB search
MNEAWKIVGIPRFGGILVVSDHASNHVPADIDLGIAPGLLDQHVAIDIGVAEVGALMAQR
PGIAAFQGGVSRLVCDFNRDEHLPTVVPIASDGHAIPGNALDHAGHEARLARFFRPYHDA
LGKLLADVPQALILSLHSFTPQLASSEEPRPWHVGVLYNEDDRAARIAIPLLQAEGLCVG
DQLPYSGKLLNATMNRHAEADGRPYLGIEVRQDLIGDGAGQVEWAERLSRIANQVAVAIT
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaagcctggaagatcgtcggcataccccgcttcggtggcatcctggtcgtgtcc
gatcatgcctccaaccacgtgccggccgacatcgacctcggcatcgcgcccggactgctg
gaccagcacgtcgccatcgacattggcgtggccgaagtcggcgcgctgatggcgcagcgt
cccggcattgccgcgttccagggcggcgtcagccgcctcgtctgcgatttcaaccgcgat
gagcatctgcccaccgtcgttcccatcgccagcgacggtcacgccattcccggcaatgcg
cttgaccacgccggacacgaagcccgtctcgcgcgcttcttccgcccttatcacgacgcc
cttggcaagttgctggccgacgtcccgcaggcgctgatcctttcgctccacagcttcacg
ccacaactggcatcgagcgaagagccgcgtccctggcacgtcggcgtgttgtacaacgag
gacgaccgcgccgcccgcatcgccatccccctgcttcaggccgaaggactctgcgtgggc
gaccagcttccctattcgggcaagcttctgaacgcgacgatgaaccgccatgccgaggcc
gacggcaggccctaccttggcatcgaggtacgccaggacctgatcggcgatggcgcgggc
caggtcgaatgggcggaacgcctgtcgcgcatcgccaatcaggttgcggttgcaattacc
tag

DBGET integrated database retrieval system