KEGG   Novosphingobium aromaticivorans: Saro_1786Help
Entry
Saro_1786         CDS       T00322                                 

Definition
(GenBank) YjeF-related protein-like protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1884003..1885409
Genome map
AA seq 468 aa AA seqDB search
MPRSRDRLLTQVLNVAQMHAAEQALIAAGTDVHQLMQRAGRGAGEWVRRIAAGRPVTVLC
GPGNNGGDGWVIAEYLREHGNPVTVVVAREPGTGAAKTARSLYRGAAVPGDAAVEGEVLV
DCLFGSGLTRGLSDDLFELLACLARRHPHRIAIDVPSGVESDSGRPLNAGLPQSTLTIAL
GAWKHAHFAMPACAMMGVLRLVDIGVNEVPGAARVLARPSISVPAADAHKYRRGMLGIVA
GAMPGATILASTAALRAGAGYVKLAASAAPANAPAELVVTSDLSAMLADDRLAALLVGPG
FGRGDEAARILARSLHAARPSVVDADGLMLLRPAMLSGTPMVLTPHDGEMAALERAFDLP
ASGLRRERALALAAASKAVVVLKGPDSVIAGPEGELVVSPRASSWLSVAGTGDVLAGTIA
SRLAVHGDAMRAAEEGLWLHGEAARIVGSAFTAGELACAVRAAVEECL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcagccgtgaccgcttgctcacgcaggtccttaacgtcgcgcagatgcacgcg
gccgagcaggcgttgatcgcggcgggaaccgacgtccaccagctcatgcagcgggccggg
cgcggcgcgggcgagtgggtgcgacggatcgcggccggccgccccgtcacggtgctctgc
gggccgggcaataatggcggcgacggttgggtcatcgccgaatatctgcgagagcacggc
aatccggtaacggtcgttgtcgcacgcgagccgggcacgggtgcggcgaagaccgctcgc
tcgctctatcgcggtgccgccgtgcccggtgacgctgcggtagagggcgaagtgcttgtc
gattgcctgttcggtagcggcctgacgcggggcctgtcggacgatctcttcgagctgctt
gcctgtcttgcccggcgccatcctcatcgtatcgccatcgatgtgccgagcggcgtggaa
agcgatagcggacgcccgctcaatgccggcctgccgcaatcgaccctgaccatcgccctc
ggggcctggaagcatgcgcatttcgcgatgcccgcctgcgcgatgatgggcgtgctgcgc
ctcgttgacatcggcgtgaacgaagtgccgggagcggcgcgcgtgctggcaaggccatcc
atctccgtgcccgccgccgatgcccacaagtaccgccggggcatgctcgggatcgtggcc
ggggcaatgccgggggcgaccattctcgcctcgacggcggcgctgcgggcaggggcgggc
tatgtgaagcttgccgcctccgccgcgcccgcgaacgctccagccgaactggtggtgacc
tccgatctttccgcgatgcttgccgacgatcgccttgcggcgctgctggtcggccccggc
ttcgggcgcggcgacgaggccgcgcgcatccttgcccggtcgctgcacgccgcgaggccc
agcgtggtcgacgcggacgggctcatgctccttcgccccgccatgctttcggggacgccg
atggtgctgacgccgcacgacggggaaatggccgcactggaacgcgcgttcgaccttccg
gcgagcgggctccgccgcgagcgtgcgctcgcgctggctgctgccagcaaggccgtggtc
gtgctcaaggggccggacagcgtgatcgcagggccggagggcgaactcgtcgtttcgccg
cgcgcttcgtcgtggctgtccgtggccgggaccggcgatgtcctggccgggaccatcgcg
agccgcctggccgttcatggagatgccatgcgcgccgccgaggaaggtttgtggctgcac
ggcgaggcggccaggatcgtcggctccgcctttaccgccggggaactggcctgcgccgtg
cgtgcggctgtcgaggaatgtctttga

DBGET integrated database retrieval system