KEGG   Novosphingobium aromaticivorans: Saro_1787Help
Entry
Saro_1787         CDS       T00322                                 

Definition
(GenBank) 23S rRNA m(5)U-1939 methyltransferase
  KO
K03215  
23S rRNA (uracil1939-C5)-methyltransferase [EC:2.1.1.190]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.190  23S rRNA (uracil1939-C5)-methyltransferase
     Saro_1787
Ribosome biogenesis [BR:nar03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Saro_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1885409..1886614
Genome map
AA seq 401 aa AA seqDB search
MNDAGLIVRVAAKGEGATADGRYAALAAPGDTLLPDGTLVHGPDHVDPACRHFPTCGGCQ
LQHLSEAALSAYVFDRVVGAAKGQGLEPAATTPAHLSPPRTRRRATLHAQAIGKRVVIGF
REQGSHKIVDMRECHVLAIELFALVGPLRALLEGWNDRKLAVDIELALSDQGASVGLKGL
AAEGLAKTEALLDFARDNGLARLTLDAGYGPEGVWEPEPVTVTLGGTPVALPPGAFLQAT
ADGEAALVGAAREWLSGAATVADLFSGLGTFAFALAGPATKVLAVEAAREPYMVCQAAAR
MNGRPVHALHRDLFRNPLRVEELDRFAAVLIDPPRAGAQEQVEQIAASKVARVVYVSCNP
ASWARDAVRLIAGGYRLAEVRPVGQFRWSTHVELASLFIRD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgccggcctgatcgtgcgcgttgccgccaagggcgagggggcaactgccgac
ggacgctatgccgcgctggccgcgcctggcgatacgctcctgcccgacggtacgcttgtc
cacgggcccgaccacgtcgatcccgcttgccgccatttcccgacctgcggtggttgccag
ttgcagcacctgtccgaagccgcgctttctgcctatgtgttcgaccgcgtggtcggtgcg
gcgaaggggcagggcctcgaacctgccgccaccacgcccgcgcacctctcgccgccccgc
acgcgtcgtcgcgccacgctccatgcgcaggcaatcggcaagcgcgttgtcatcggtttt
cgcgaacagggttcgcacaagatcgtcgacatgcgcgaatgccatgtgctcgcgattgag
ctcttcgcgctggtcggcccgttgcgcgcgctgctggaaggctggaacgaccgcaagctc
gccgtcgacatcgagcttgcgctttccgaccagggggcgtccgtcgggctgaagggcctt
gcggcggaaggcctcgccaagaccgaggcgctgctcgatttcgcccgcgacaatggcctc
gcgcggttgacgctcgatgccggttacggtccggaaggcgtgtgggagccggaacctgtc
actgtgacgctcggcggaacgcccgtcgccctgcccccgggcgccttcctgcaggcgacg
gcggatggcgaggccgcgcttgtcggcgcggcgcgcgagtggttgtcgggtgctgcgacc
gtggccgaccttttctctggcctgggcacgtttgccttcgcgctggccggacccgcgacc
aaggtcctcgcggtcgaggccgcgcgcgagccatacatggtctgccaggcagcggcgcgg
atgaatggccgcccggtccatgcgcttcaccgcgacctgttccgcaatcccctgcgtgtc
gaggaactggaccgcttcgccgccgtgctgatcgacccgccccgtgccggcgcgcaggaa
caggtcgaacagatcgctgccagcaaggtggcgcgcgtggtctatgtcagttgcaatccg
gcaagctgggcgcgtgatgccgtgcgcctgatcgcaggtggctacaggctggcggaagtg
cgcccagttggccagttccggtggtcgacccacgtcgaactggccagcctgttcatccgc
gactga

DBGET integrated database retrieval system