KEGG   Novosphingobium aromaticivorans: Saro_1790Help
Entry
Saro_1790         CDS       T00322                                 

Definition
(GenBank) carboxynorspermidine dehydrogenase
  KO
K00290  
saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Lysine biosynthesis
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Saro_1790
   00310 Lysine degradation
    Saro_1790
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.7  saccharopine dehydrogenase (NAD+, L-lysine-forming)
     Saro_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1887709..1888914
Genome map
AA seq 401 aa AA seqDB search
MAKVLVIGAGGVGSVAVHKMAMNADIFTGIALASRTKSKCDAIAASVKERTGVTVDTYQI
DADDVAATTALINEVKPVLVVNLALPYQDLHIMDACLAAGVNYMDTANYEPIDEAKFEYS
WQWAYQDKFKQAGLMALLGSGFDPGVTSVFATWLKKHKLDTIRTLDILDCNGGDHGQHFA
TNFNPEINIREVTAPARHYLKGEWVETPALTIRHQFDFEEVGPKNMYLMYHEELESLAKH
LPEIERIRFWMTFGDAYITHLTVLQNVGMTRIDPVMYEGKEIIPLQFLKAVLPEPASLGP
TTKGKTNIGDIATGLKDGVEKTFYIYNICDHEDAYRETGNQAVSYTTGVPAMIGAAMMVQ
GIWSGEGVFNIEQFDPDPYMDMLNKHGLPWQVKELAGPLEF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttctcgtcatcggcgcaggcggcgtcggctcggttgcggtccacaagatg
gcgatgaatgccgatatcttcacgggcatcgcgctcgccagccgcacaaagtcgaagtgc
gacgccattgccgcctcggtgaaggagcgcaccggcgtcaccgtcgacacctaccagatc
gatgcagacgacgtcgccgcgacgaccgcgttgatcaacgaggtcaagcccgtcctcgtc
gtcaatctcgcgctgccctaccaggacctgcacatcatggacgcctgccttgccgccggc
gtcaactacatggataccgcgaactacgagccgatcgacgaggcgaagttcgagtattcg
tggcagtgggcctaccaggacaagttcaagcaggcaggcctcatggccctgctcggttcg
ggcttcgatccaggcgtgaccagcgtcttcgccacctggctcaagaagcacaagctcgac
acgatccggacgctcgacattctcgactgcaacggcggcgatcacggccagcatttcgcc
accaacttcaacccggaaatcaacatccgcgaagtgaccgcgcctgcgcgccactacctg
aagggtgaatgggtcgaaacgcctgccctgaccatccgccatcagttcgacttcgaggaa
gtcggccccaagaacatgtacttgatgtaccacgaggaactcgaaagcctcgccaagcac
ctgcccgagatcgagcgcatccgcttctggatgacgttcggcgatgcctacatcacgcac
cttaccgtgctgcagaacgtgggcatgacccgcatcgacccggtcatgtacgagggcaag
gagataatcccgctccagttcctcaaggccgttctgcccgaaccggccagcctcggcccg
acgaccaagggcaagacaaacatcggcgacatcgccaccggtctcaaggatggcgtcgag
aagaccttctacatctacaacatctgcgaccacgaggacgcctaccgagagaccggcaac
caggcggtcagctatacgaccggcgtgcccgcgatgatcggtgccgcgatgatggtgcag
ggcatctggtcgggcgaaggcgtgttcaacatcgagcagttcgatcccgatccctacatg
gacatgctcaacaagcatggcctgccctggcaggtgaaggaactggcgggtccgctggag
ttctga

DBGET integrated database retrieval system