KEGG   Novosphingobium aromaticivorans: Saro_1791Help
Entry
Saro_1791         CDS       T00322                                 

Definition
(GenBank) conserved hypothetical transmembrane signal peptide protein
  KO
K09922  
uncharacterized protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1888914..1889264
Genome map
AA seq 116 aa AA seqDB search
MNPSALYPVLLLAGSNLVMNVAWYGHLKVPNRALWIAVLASWGLAFFEYWMAVPANRIGS
RVYSLAELKTLQEVMSLSTFLIVAWVMFGSRPGLSQLAGMALIAAGAFLVYKSPLG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtcggccctatatccggtactcctgctggccgggtcgaatctggtgatgaac
gtggcgtggtacggtcacctgaaggtgccgaaccgcgccctgtggatcgcggtcctggca
agctgggggctggcgttcttcgaatactggatggctgtccccgccaaccgcatcggctcg
cgggtctattcgctggccgaactcaagacgcttcaggaggtgatgtcgctctcgacgttc
ctcatcgtcgcgtgggtcatgttcggcagccgaccgggcctcagccagcttgccggcatg
gcgctgatcgcggcaggcgcgtttctcgtctacaagtcgccgcttggataa

DBGET integrated database retrieval system