KEGG   Novosphingobium aromaticivorans: Saro_1793Help
Entry
Saro_1793         CDS       T00322                                 

Definition
(GenBank) 6-aminohexanoate-dimer hydrolase
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1890515..1891741
Genome map
AA seq 408 aa AA seqDB search
MAGELLDGLTSDPVRMGWMQGSPPPPEKVLLAARADHMRFPMIRWSYSNMRQFVPTRRVA
ASGEGRPFERALRPDLADVSFVPLGGDDPVAFGQSLAEAFTDGILVLHRGKVVLERWLGV
TGPQTRHIAFSVTKSFVGTIVEMLADEGRIDPAAMISAYLPEMAGSGFADATVRQVLDMT
TALDFSEDYADPESGIGAYSAALGLTPRKPDYAGPADLWSFLPSVAKSGDHGRGFTYRTP
NTDVLAWLVSRVEGRHFADVLTERLWQPLGMLGDADLIVDQAGSPFAGGGLNLRLEDLAR
FGEAMRLGGLGVIPAGVVARIASGGDPAHFDRTRYPQLPGWSYGSQWWISNNAHGCFSAR
GIHGQTLWVDPAAEMTIARFASHPTAANGANDPLSLPAWAALADALSR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgaactgctcgacgggctgacgagcgatccggtgcgtatgggctggatgcag
ggctcgccgccgccgccggaaaaggtcctgcttgccgctcgcgcggatcacatgcgcttt
ccgatgatccgttggtcatattccaacatgcgccagttcgtgcccacgcgccgcgtcgcc
gcttcgggcgagggacggccgttcgagcgcgccttgcgtcccgatctcgcggacgtctcg
ttcgtgccgctcggcggcgatgatccggtcgcattcggacaatcgctggccgaggccttt
actgatggcatccttgtccttcaccgcggcaaggtcgtgctcgaacgctggctcggcgtg
accggaccccagacccgccacattgccttttccgtgaccaagagcttcgtcggcacaatt
gtagaaatgctggcggatgaagggcgcatcgatccggcggcaatgatttccgcctacctg
cccgaaatggccggcagcggctttgccgacgcgacggtgcggcaggtgctcgacatgacc
accgcgctcgatttctccgaggactacgccgatcccgaatccggcatcggcgcctacagc
gcagcgctcggcctgaccccgcgcaagcccgactacgcggggccggccgacttgtggagt
ttcctgccgtcggtggcgaagtcgggcgatcatggccgtggcttcacctaccgcacgccc
aataccgacgttcttgcgtggctggtcagccgggtagagggccggcacttcgccgatgtc
ctgaccgagcgtttgtggcagccgctcggaatgctgggtgatgccgacctgatcgttgac
caggcgggctcgccctttgccggcggcggcctcaacctccgtctggaagaccttgcccgc
tttggcgaggccatgcgtctgggtggccttggcgtcattcccgccggcgtcgtcgcgcgc
atcgccagcggcggcgatccagcgcatttcgaccgcacccgctacccgcaacttccgggg
tggagctatggcagccagtggtggatcagcaacaatgcccatggatgcttctccgcacgg
ggcatccacgggcagacgctctgggtcgacccggcggctgaaatgaccatcgctcgattc
gcgtcgcatcccactgccgccaacggcgcgaacgacccgctatccctgcctgcgtgggcc
gcactggccgatgctctaagtcgctga

DBGET integrated database retrieval system