KEGG   Novosphingobium aromaticivorans: Saro_1799Help
Entry
Saro_1799         CDS       T00322                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  
glutamate racemase [EC:5.1.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Saro_1799
Enzymes [BR:nar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Saro_1799
Peptidoglycan biosynthesis and degradation proteins [BR:nar01011]
 Precursor biosynthesis
  Racemase
   Saro_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1896831..1897664)
Genome map
AA seq 277 aa AA seqDB search
MTGTGTVANQAATVDPGAPLLLFDSGVGGLSVLRKVRAVLPEAPVIYVADNAGLPYGAKT
EAQIAARVSGLLGRLTERLAPRLVCIACNTASTIALASVREVLEVPIVGTVPAIKPAAAL
TRTGVIGLLGTEATIRQAYVDRLEAEFAADKHLLRHGAPELVAAAEAKLRGERVDPAVYA
RAAAALRAMPGGDRIDTVVLACTHFPLVEDELREAFGPEVRFVDGSDGIARRIAHLTQGQ
AWRRTEPDLALFTRGGEDVDRLGPALAAHGLGRIGIF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaacgggcacagttgcgaaccaagcggccacggtcgatccgggagcgccgctg
ctcctgttcgattcgggcgttggcgggctttcggtgctgcgcaaggtgcgggccgtgctg
cccgaggctccggtcatctacgtcgccgacaacgccggccttccctatggcgcgaagacc
gaagcgcagatcgccgcgcgcgtctcgggtctgctcggccgactgacggaacggctggcg
ccccgcctggtgtgcatcgcctgcaatacggcgtcgaccattgccctggcatcggtccgc
gaagtgctggaagtgccgatcgttggcaccgttccggcgatcaagcctgccgccgcgctt
acccgcaccggcgtcatcgggcttcttggcaccgaagcgacgatccggcaggcctatgtc
gaccggctcgaggcggagttcgccgccgacaagcacctgctgcgccacggcgcgcccgaa
ctcgtagccgcggccgaagccaagctgcgcggcgaacgggtcgatccggccgtctatgcc
cgggccgcagcggccctgcgcgcgatgcccggcggagaccggatcgacacggtggtgctt
gcctgtacgcacttcccgctggtcgaggacgaattgcgcgaagccttcgggccggaagtc
cggttcgtcgacggatcggacggcattgcccgccgcatcgcccacctcacgcagggacag
gcctggcgcaggacggaacccgacctcgcgctgttcacgcgcggcggcgaggacgtcgac
cggctcggccccgcgcttgcagcgcacgggcttggccgcatcgggatattctga

DBGET integrated database retrieval system