KEGG   Novosphingobium aromaticivorans: Saro_1802Help
Entry
Saro_1802         CDS       T00322                                 

Definition
(GenBank) hypothetical protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1899458..1899820
Genome map
AA seq 120 aa AA seqDB search
MADLRLARRIFRGAAIYGFIVLPPMLLAPWPQKGPEVLVGFVGLALVFQAVFWIIGGDPR
RYRPVMLAAIAEKLVFGVPALVLVAQGRTEPVVGFFAAMDVLLAAAFMVAYRATPPDPPA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccttcgccttgcgcgccgcatcttccggggtgccgcaatctacggcttcatc
gtgcttccgccgatgctgctcgcgccctggccgcaaaagggcccggaggtgctggtcggc
ttcgtcggcctggcgctggtgttccaggcggtgttctggatcatcggcggcgatccgcgc
cgctaccggccggtcatgctcgcggccatcgcggaaaagctggtgttcggcgtacccgcg
ctggttctggtggcgcaaggacggacggaacccgtcgtgggcttcttcgccgccatggac
gtcctgctcgcagccgctttcatggtggcctatcgggcaaccccgcccgatcctccggct
tga

DBGET integrated database retrieval system