KEGG   Novosphingobium aromaticivorans: Saro_1807Help
Entry
Saro_1807         CDS       T00322                                 

Definition
(GenBank) RNAse III
  KO
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
nar  Novosphingobium aromaticivorans
Brite
Enzymes [BR:nar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     Saro_1807
Messenger RNA biogenesis [BR:nar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Saro_1807
Ribosome biogenesis [BR:nar03009]
 Eukaryotic Type
  90S particles
   RNase
    Saro_1807
 Prokaryotic Type
  rRNA processing factors
   Saro_1807
Chromosome [BR:nar03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     Saro_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1906007..1906765)
Genome map
AA seq 252 aa AA seqDB search
MVDRRQRQLVPALDLVHRCPLEPDRGHVLSALAPEASAFIAALTGAAPARPEIWAEALTH
GSMGEPRDYQRLEFLGDRVLGLAIADWLHEKSDAAEGKLSQRLNALVSRETCADVARTIG
LAGHIRLGKQARDDGGAQSDNILGDVMEALIGALFVERGFEAARKFVRKAWEKPMLSGTG
QRKHPKAALQEWAAGNRRKPPVYTLVSREGPDHAATFTVSVEVKGVGEASARGSSKQEAE
TAAARAFMQAYA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaccgacggcagcgccaactggttcctgccctggacctggttcaccgctgcccg
ctggaaccggatcgggggcacgttctgagcgcgcttgccccggaggccagcgccttcatc
gccgccctcaccggtgcagcgccggcgcgcccggaaatctgggcggaagccctcacccac
ggatcgatgggcgagccgcgcgattaccagaggctcgagttcctcggcgaccgtgtcctt
ggcctcgccatagcggactggcttcacgagaagagcgatgccgccgaaggcaagctttcg
cagcgcctcaacgctctggtcagtcgcgagacgtgcgccgatgtcgcacgaaccatcggc
cttgccgggcacatccgccttggcaagcaggcgcgcgatgacgggggcgcacagagcgac
aacattctgggcgacgtgatggaggcgctgatcggtgcgctcttcgtggagcgcggattc
gaggcggcgcgcaagttcgtgcgcaaggcctgggaaaagccgatgctctcgggcaccggc
cagcgcaagcaccccaaggccgcgcttcaggaatgggcagcgggcaaccgccgcaagccg
ccggtctatacgctcgtttcgcgcgaggggccggaccatgccgccaccttcaccgtttcg
gtcgaggtcaagggcgtgggcgaggcaagcgcgcgcggatcttccaagcaggaagcggaa
accgccgctgcccgggctttcatgcaggcttatgcctga

DBGET integrated database retrieval system