KEGG   Novosphingobium aromaticivorans: Saro_1809Help
Entry
Saro_1809         CDS       T00322                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saro_1809
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1809
   00030 Pentose phosphate pathway
    Saro_1809
   00500 Starch and sucrose metabolism
    Saro_1809
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_1809
Enzymes [BR:nar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Saro_1809
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Saro_1809
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_1809
  Exosomal proteins of colorectal cancer cells
   Saro_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1907699..1909222
Genome map
AA seq 507 aa AA seqDB search
MTVAEAETYWTALAGLPRPTLKELFSDAGRLDRYAATLDLPGGPIRFDWSKTHLSAEVEA
VFAALASAMDFEGRRAALIEGAKINNTEGRAAEHTAQRGIGNEASVEEAEALHARMRMLV
DAIHAGALGEVRSLIHIGIGGSALGPALAIDALTRDGAKVAVHVVSNIDGCALEAAMKAC
DPATTMIAVASKTFTTTETMTNAASALEWLRENGVADPYGQVVALTAAPEKAVEWGVDET
RVLPFSETVGGRYSLWSSIGFPVAMALGWEGFAAFLDGAAAIDRHFIDADLAGNVVVRAA
FADLYYTQVRGCQTRAVFAYDERLALLPDYLQQLEMESNGKRVLADGSPLTRPSAPVTWG
GVGTDAQHAVFQLLHQGTHLIPVDFLAVKTQGHDLDPAHHQILLSNCFAQGAALMAGKAS
DDGARAYPGDRPSATILCDDLNPATLGALIAFHEHRTFVSAVMLGINPFDQFGVELGKAI
AKQIESGGGEGFDPSTEALLAAVGLAG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgccgaagcggaaacgtactggacggcgctggccgggctgccgcgcccgacg
ctcaaggagctgttctccgatgccggccgtctcgatcgctacgccgctacgctcgacctg
ccgggcggcccgatccgcttcgactggtccaagacgcacctctccgccgaagtggaagcg
gtgttcgccgcgcttgcatcggcgatggacttcgaaggccgccgcgccgcgctgatcgag
ggcgcgaaaatcaacaacaccgaaggccgcgcggccgagcacaccgctcagcgcggcatc
ggcaacgaggccagcgtcgaggaagccgaggcgctccacgcccgcatgcgcatgctggtc
gacgcgatccacgccggtgcgcttggcgaagtgcgcagcctgatccacattggcatcggc
ggttcggcgctcgggccggcgctggcgatcgacgcactgacccgcgacggcgcgaaggtg
gccgtccacgtcgtgtcgaacatcgacggctgcgcgctcgaagccgctatgaaggcctgc
gatccggcaacgacgatgatcgccgttgcctccaagaccttcaccacgaccgagacgatg
accaacgctgcctcggcgcttgaatggctgcgcgagaacggcgttgccgatccctatggc
caggtcgttgcgctcaccgccgcgcccgagaaggcggtcgagtggggcgtcgacgaaacc
cgcgtcctgccgttctccgaaaccgtgggcgggcgttactcgctgtggtcgtcgatcggt
ttcccggtcgcgatggcgctggggtgggaaggcttcgccgcgttcctcgacggtgcggcg
gctatcgatcgccatttcatcgacgcagacctggccggcaacgtcgtcgttcgcgccgcc
tttgccgatctctattacactcaggttcgcgggtgccagacgcgtgcggtcttcgcctat
gacgaacgcctcgcgcttctgccggactatctccagcagctcgaaatggaatcaaacggc
aagcgcgtcctcgccgatggctctccacttacacggccaagcgcgccggttacctggggc
ggcgtcgggaccgatgcacagcatgccgtgttccagctcctgcaccagggtacgcacttg
attccggtcgatttccttgccgtcaagacgcagggccacgacctcgacccggcgcatcac
cagatcctgctttccaactgcttcgcccagggtgctgcgctcatggccggcaaggcgagc
gatgacggcgcgcgtgcctatcccggcgaccgtccttccgcgacgatcctgtgcgacgat
ctcaaccccgcgacgctcggcgcgctgatcgccttccacgagcatcgcacgttcgtctct
gcggtgatgctcggcatcaatcccttcgaccagttcggcgtcgaactgggcaaggccatt
gccaagcagatcgagtctggcggcggcgaaggcttcgatccgtcgaccgaagcactcctg
gcagcggttggcctcgccggctga

DBGET integrated database retrieval system