KEGG   Novosphingobium aromaticivorans: Saro_1812Help
Entry
Saro_1812         CDS       T00322                                 

Definition
(GenBank) oxidoreductase, molybdopterin binding protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1911497..1912246)
Genome map
AA seq 249 aa AA seqDB search
MTLVSRRSALIGTLGLAVAGCDRITTSPTVRKVLTLGEKATLSGQRLVTDRNALAPEFTT
ADLSPRFRVNGNRMPASADYQAHMASGFSTWQLEVGGLVRQPLRLSLAQLMSAPQRTQIT
RHDCVEGWSAIGEWTGVPLALLLRKAGISSNAQYVVFHCADDFSGMRYYESIDMIDAMHP
QTILAHTMNRQPLSVAHGAPIRLRVERQLGYKQAKYVMKIEAVDRLGGIHGGKGGYWEDH
SGYQWYAGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgtcagcagacgcagcgcactgatcggaacgcttggcctggcggtggccgga
tgcgatcgcatcacgacctccccgactgtacgcaaagtgctgacgctcggcgaaaaggcg
acgctttccgggcaacggctcgtgaccgaccggaacgcgcttgcccccgaattcacgacc
gcggacctgtcaccgcgcttccgcgtcaacgggaaccggatgcctgcgtcggccgactac
caggcacacatggcgagcggcttttcgacatggcaactggaggttggcgggcttgtgcgg
caacccttgcggctgtcgctggcgcaactcatgtctgcgccgcagcgcacgcagatcacc
cgccacgattgcgtcgaagggtggagcgcgatcggcgaatggaccggggtgccactcgcc
ctgcttctgcggaaagccggaatttcatcgaatgcgcagtacgttgtattccattgcgca
gatgatttctccggaatgcgttactacgagagcatcgacatgatcgatgcgatgcacccg
cagacgatcctggcccataccatgaaccgccagcctctttcggtggcccacggtgcgccg
atccgcctgcgggtggagcggcagcttggctacaagcaggcgaaatacgtgatgaagatc
gaggccgtggatcggctcggcggcatccacggcggcaagggtgggtactgggaggaccat
tccggctatcagtggtacgcgggcatctga

DBGET integrated database retrieval system