KEGG   Novosphingobium aromaticivorans: Saro_1813Help
Entry
Saro_1813         CDS       T00322                                 

Definition
(GenBank) cytochrome B561
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1912243..1913142)
Genome map
AA seq 299 aa AA seqDB search
MRFWRYVALSTGQLVEVAVGALGPAVDPREDAVPERAALVYRTRLPVRIWHWINALCILV
MLMSGATIFNAHPRLYWGAYGANPDSAWLEIGNQGQRGFLRIGELEIGTTGLLGWTEHST
RAFPPLVTIPNYYSLAEGRQWHFFFAWVLVISALAYLVYALLSGHLRRNLGLSREERRLS
HIWHDIKQHARLRFPTGEAARGYNPLQKMAYLGVILVVLPLVVLTGMTMSPTLNAAFPWL
LDIFGGRQSARSIHFLCAAAFCAFILVHLVMVVLAGPFNELRSMTTGWYRLPPARKGEE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcttttggcgttacgtggcactctcgaccgggcagttggtggaggtggcggtgggt
gcacttggtccggccgttgatccgcgcgaggacgcggttccggaacgcgcggcgctcgtc
taccgcacccgcctgcccgtcaggatctggcactggatcaacgcgctctgcatcttagtc
atgctgatgagcggagcgacgatcttcaacgcccatccgcgcctctactggggcgcctat
ggggcgaacccggacagtgcgtggctggaaatcggtaaccaggggcaacggggcttcctg
aggatcggtgaactggaaatcggcacgaccggcctgcttggctggaccgagcattcgacc
cgggcctttcctcccctcgtcaccattcccaactactacagccttgccgaagggcggcag
tggcatttcttctttgcgtgggtgctggtgatctcggccctagcctatctggtctacgcc
ctgctgtcgggacacctgcggcgcaatcttggcctctcgcgcgaggagcgccgcctttcg
catatctggcacgacatcaagcagcatgcgcgccttcgctttccgaccggcgaggcggcg
agagggtacaaccccttgcagaagatggcctatcttggcgtcatcctcgtggtcctgccg
ctggtggtactgacgggcatgaccatgtcgcccacgctgaacgccgcgtttccatggctc
ctcgacatcttcggcggccgccaatccgcaagatcgatacacttcctgtgtgcggcagcg
ttttgtgcgttcattctggtccacctcgtcatggtggtcctggcaggccctttcaacgaa
ctgaggtccatgaccacggggtggtaccgcctgcccccagcgaggaagggtgaagaatga

DBGET integrated database retrieval system