KEGG   Novosphingobium aromaticivorans: Saro_1816Help
Entry
Saro_1816         CDS       T00322                                 

Definition
(GenBank) amine oxidase
  KO
K10027  
phytoene desaturase [EC:1.3.99.26 1.3.99.28 1.3.99.29 1.3.99.31]
Organism
nar  Novosphingobium aromaticivorans
Pathway
Carotenoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Saro_1816
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.26  all-trans-zeta-carotene desaturase
     Saro_1816
    1.3.99.28  phytoene desaturase (neurosporene-forming)
     Saro_1816
    1.3.99.29  phytoene desaturase (zeta-carotene-forming)
     Saro_1816
    1.3.99.31  phytoene desaturase (lycopene-forming)
     Saro_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1914723..1916201)
Genome map
AA seq 492 aa AA seqDB search
MKRACVIGAGFGGLALAIRLQSGGVQTTLIEARDKPGGRAYFWEKDGFTFDGGPTVITDP
ACLEELWALKGHRMADDVELMPVMPFYRLNWADGTNFDYSNDDASLRAEIAKLEPADVAG
YDDFLRYSAGVFEEGYVKLGAVPFLDFASMIKAAPALARYQAWRSVYSMVSSFVRNEKLR
EAFSFHTLLVGGNPMTTSAIYALIHKLEKDGGVWWAKGGTNRLIEGMVTHFRRIGGEVRI
GDPVTRVETLGTRVTGVETRSGWSGKFDAVASNADVMHSYRDLLSDNSHAKRRAKSLGKK
RFSPSLFVVHFGIEGTWPGIPHHMILFGPRYKGLLDDIYTHGVLPQDFSIYLHHPTVTDP
SVAPEGMSTFYALVPVANMGKLPVNWDEVGPILEKRILDEVGRRLIPDIHTRIVTKFHYA
PSDFSTDLSAHLGSAFSLEPLLTQSAWFRAHNRDDAISNFYLVGAGTHPGAGIPGVVGSA
KATARLMLEDLS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgcatgtgtcatcggcgccggatttggcggcctcgccctcgccatccgcctg
caatcggggggcgtccagacgaccctgatcgaggctcgcgacaagccgggcgggcgcgcc
tatttctgggagaaggacggcttcaccttcgacggcggcccgaccgtcatcaccgatccg
gcgtgcctggaagagctgtgggcgctcaagggccatcgcatggccgacgacgtggaactc
atgccggtcatgccgttctaccgcctcaactgggcggacggcaccaacttcgactattcc
aacgacgacgcgagcctgcgcgctgagatcgccaagctggagccggcggacgttgccgga
tacgacgatttcctgcgctattccgccggcgtgttcgaggaaggctacgtcaagctcggc
gccgtgccgttcctcgacttcgcgagcatgatcaaggccgcgcccgcgctggcccgctac
caggcctggcgctcggtctattcgatggtctccagcttcgtccgcaacgagaagctgcgc
gaggccttcagtttccacactctgctggtcggcggaaacccgatgacgaccagcgcgatc
tatgcgctgatccacaagctggagaaagacggcggcgtgtggtgggccaagggcggcacc
aaccgcctgatcgagggcatggtgacccatttccggcggatcggcggggaagtgcggatc
ggcgatccggtaacgcgcgtcgagacgctgggaacccgggtgaccggggtcgagacccgc
agcggctggtcgggcaagttcgacgccgtagcgtcgaatgccgacgtcatgcattcgtac
cgcgaccttctgtctgacaactcacatgcaaaacgccgcgcaaagtctctcggcaaaaag
agattttcaccaagcctcttcgtcgtccacttcggcatcgaaggaacctggcccggtatc
ccgcatcacatgatcctgttcggcccgcgctacaaggggctgctcgacgacatctacacc
catggcgtgctgccgcaggacttctcgatctacctgcaccatcccaccgtgacggacccc
tcggtcgcgcccgaaggtatgagcacgttctacgcgctggtgccggtggcgaacatgggc
aagttgccggtcaactgggacgaggtcggtcccatcctcgagaagcgcatactggatgaa
gtgggccgcaggctcatccccgatatccacacgcgtatcgtaacgaagttccattacgct
ccgagcgacttctcgaccgatctttccgcgcacctcggaagtgcattcagccttgaaccg
ctgctcacgcaaagtgcatggttccgggcacataatcgcgacgacgcgatttccaatttc
taccttgtcggcgcggggacgcaccccggtgccggcattccgggcgtggtcggctctgcc
aaggccacggcaaggctgatgctggaggatctttcgtga

DBGET integrated database retrieval system