KEGG   Novosphingobium aromaticivorans: Saro_1819Help
Entry
Saro_1819         CDS       T00322                                 

Definition
(GenBank) flavin-containing monooxygenase FMO
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1918216..1919733
Genome map
AA seq 505 aa AA seqDB search
MAEQAQAGGDFDVLIVGAGISGIGSAWHLQDQCPDKTYAIIESKDTFGGTWETHKYPGVR
SDSDLYTFGYRFKPWVGAPIASAQAILDYMGEVIDEAGIDRHIRYGHTITSARWSSETNR
WTLEARRKDGTTATFTANFLWMCQGYYDHQVPYIPKEWKGVSDFKGLFVHAQLWDPATDW
EGKRILVIGSGATAATVVPAFADKAQVTMLQRSPTYFYCHPNQNELADRLRQIGIDEPTI
HRVVRAQIMHDQAVMDKRCVDEPDVVFEELKMAVRAYAGEDFEFEPHFTPKYRPWQQRLA
FCPDGDLFRAAAEGKVRVVTDTIDRFTEKGVLTASGELLEADIIVACTGFHLKVLGDIPF
EVDGKAVNWGDTVTYRGMMFTGVPNMVWVFGYFRASWTLRVDMMGDFVCRLLRHMDERGV
KKVEVAFRDEDSGMKILPWIEADNFNPGYLMRDLDKLPKRGDKSEWRHNQNYWLEREAFP
AIDLDGQEFIYNGVRAEPRVVEAAE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaagcgcaggctggcggcgatttcgacgtattgatcgtcggcgccggcatt
tcgggcatcgggtccgcatggcatcttcaggaccagtgccccgacaagacctatgcgatc
atcgagagcaaggacactttcggcgggacctgggaaacccacaagtatcccggcgtgcga
tcggattccgacctttacaccttcggctaccgtttcaagccgtgggtcggtgcgccgatc
gcgagcgcgcaggcgatcctcgactacatgggcgaggtgatcgacgaagccgggatcgac
cgccacatccgctatggccacacgatcacgagcgccagatggtcgagcgagaccaaccgc
tggacgctggaggcgcggcgcaaggatggcacgaccgccacgttcaccgcgaacttcctg
tggatgtgccaggggtactacgaccaccaggtcccctacattccgaaggaatggaagggc
gtatcggacttcaagggcctgttcgtccacgcccagctctgggacccggcgaccgactgg
gaaggcaagcgcatcctcgtgatcggatcgggcgcgaccgccgccacggtggtccccgcc
tttgccgacaaggcgcaggtcacgatgctccagcgttcgccgacctatttctactgccat
cccaaccagaacgagctggccgaccgcctgcgccagatcggcatcgacgagccgaccatc
catcgcgtcgtgcgcgcgcagatcatgcatgaccaggccgtgatggacaaacgctgcgtc
gatgaacccgacgtcgtgttcgaggagctgaagatggccgtccgcgcctatgcgggcgag
gatttcgagttcgagccgcacttcacgccgaagtaccggccctggcagcagcgactggca
ttctgtcccgacggcgacctgttccgcgctgccgccgagggcaaggtgcgcgtcgtgacg
gacaccatcgaccggttcaccgaaaagggtgtgctgaccgcttcgggcgaactgctcgaa
gcggacatcatcgtcgcctgcaccggcttccatctcaaggtgctgggcgacattccgttc
gaggtcgatggcaaggcggtgaactggggcgataccgttacctatcgcggcatgatgttc
accggcgtgcccaacatggtctgggtattcggctatttccgggcaagctggaccctgcgc
gtcgacatgatgggagacttcgtctgccgcctgctcaggcacatggacgagcgaggagtg
aagaaggtcgaagtggccttccgcgacgaggattccggcatgaagatcctgccgtggatc
gaggccgacaacttcaatcccggctatctcatgcgcgatctggacaagctgcccaagcgc
ggcgacaagagcgaatggcgccacaaccagaactactggctggagcgcgaggcctttcct
gcgatcgatctcgatggtcaggagttcatctacaacggcgtccgcgccgagccgcgcgta
gttgaggcggcggagtag

DBGET integrated database retrieval system